| Title: | Bottom-Up Proteomics and LiP-MS Quality Control and Data Analysis Tools |
|---|---|
| Description: | Useful functions and workflows for proteomics quality control and data analysis of both limited proteolysis-coupled mass spectrometry (LiP-MS) (Feng et. al. (2014) <doi:10.1038/nbt.2999>) and regular bottom-up proteomics experiments. Data generated with search tools such as 'Spectronaut', 'MaxQuant' and 'Proteome Discover' can be easily used due to flexibility of functions. |
| Authors: | Jan-Philipp Quast [aut, cre] (ORCID: <https://orcid.org/0000-0003-2713-778X>), Dina Schuster [aut] (ORCID: <https://orcid.org/0000-0001-6611-8237>), ETH Zurich [cph, fnd] |
| Maintainer: | Jan-Philipp Quast <[email protected]> |
| License: | MIT + file LICENSE |
| Version: | 1.0.0 |
| Built: | 2026-06-13 06:40:20 UTC |
| Source: | https://github.com/jpquast/protti |
The STRING database provides a resource for known and predicted protein-protein interactions.
The type of interactions include direct (physical) and indirect (functional) interactions.
Through the R package STRINGdb this resource if provided to R users. This function
provides a convenient wrapper for STRINGdb functions that allow an easy use within the
protti pipeline.
analyse_functional_network( data, protein_id, string_id, organism_id, version = "12.0", score_threshold = 900, binds_treatment = NULL, halo_color = NULL, plot = TRUE )analyse_functional_network( data, protein_id, string_id, organism_id, version = "12.0", score_threshold = 900, binds_treatment = NULL, halo_color = NULL, plot = TRUE )
data |
a data frame that contains significantly changing proteins (STRINGdb is only able to plot 400 proteins at a time so do not provide more for network plots). Information about treatment binding can be provided and will be displayed as colorful halos around the proteins in the network. |
protein_id |
a character column in the |
string_id |
a character column in the |
organism_id |
a numeric value specifying an organism ID (NCBI taxon-ID). This can be obtained from here. H. sapiens: 9606, S. cerevisiae: 4932, E. coli: 511145. |
version |
a character value that specifies the version of STRINGdb to be used. Default is 12.0. |
score_threshold |
a numeric value specifying the interaction score that based on STRING has to be between 0 and 1000. A score closer to 1000 is related to a higher confidence for the interaction. The default value is 900. |
binds_treatment |
a logical column in the |
halo_color |
optional, character value with a color hex-code. This is the color of the halo of proteins that bind the treatment. |
plot |
a logical that indicates whether the result should be plotted or returned as a table. |
A network plot displaying interactions of the provided proteins. If
binds_treatment was provided halos around the proteins show which proteins interact with
the treatment. If plot = FALSE a data frame with interaction information is returned.
# Create example data data <- data.frame( uniprot_id = c( "P0A7R1", "P02359", "P60624", "P0A7M2", "P0A7X3", "P0AGD3" ), xref_string = c( "511145.b4203;", "511145.b3341;", "511145.b3309;", "511145.b3637;", "511145.b3230;", "511145.b1656;" ), is_known = c( TRUE, TRUE, TRUE, TRUE, TRUE, FALSE ) ) # Perform network analysis network <- analyse_functional_network( data, protein_id = uniprot_id, string_id = xref_string, organism_id = 511145, binds_treatment = is_known, plot = TRUE ) network# Create example data data <- data.frame( uniprot_id = c( "P0A7R1", "P02359", "P60624", "P0A7M2", "P0A7X3", "P0AGD3" ), xref_string = c( "511145.b4203;", "511145.b3341;", "511145.b3309;", "511145.b3637;", "511145.b3230;", "511145.b1656;" ), is_known = c( TRUE, TRUE, TRUE, TRUE, TRUE, FALSE ) ) # Perform network analysis network <- analyse_functional_network( data, protein_id = uniprot_id, string_id = xref_string, organism_id = 511145, binds_treatment = is_known, plot = TRUE ) network
Performs an ANOVA statistical test
anova_protti(data, grouping, condition, mean_ratio, sd, n)anova_protti(data, grouping, condition, mean_ratio, sd, n)
data |
a data frame containing at least the input variables. |
grouping |
a character column in the |
condition |
a character or numeric column in the |
mean_ratio |
a numeric column in the |
sd |
a numeric column in the |
n |
a numeric column in the |
a data frame that contains the within group error (ms_group) and the between
group error (ms_error), f statistic and p-values.
data <- data.frame( precursor = c("A", "A", "A", "B", "B", "B"), condition = c("C1", "C2", "C3", "C1", "C2", "C3"), mean = c(10, 12, 20, 11, 12, 8), sd = c(2, 1, 1.5, 1, 2, 4), n = c(4, 4, 4, 4, 4, 4) ) anova_protti( data, grouping = precursor, condition = condition, mean = mean, sd = sd, n = n )data <- data.frame( precursor = c("A", "A", "A", "B", "B", "B"), condition = c("C1", "C2", "C3", "C1", "C2", "C3"), mean = c(10, 12, 20, 11, 12, 8), sd = c(2, 1, 1.5, 1, 2, 4), n = c(4, 4, 4, 4, 4, 4) ) anova_protti( data, grouping = precursor, condition = condition, mean = mean, sd = sd, n = n )
The type of missingness (missing at random, missing not at random) is assigned based on the comparison of a reference condition and every other condition.
assign_missingness( data, sample, condition, grouping, intensity, ref_condition = "all", completeness_MAR = 0.7, completeness_MNAR = 0.2, retain_columns = NULL )assign_missingness( data, sample, condition, grouping, intensity, ref_condition = "all", completeness_MAR = 0.7, completeness_MNAR = 0.2, retain_columns = NULL )
data |
a data frame containing at least the input variables. |
sample |
a character column in the |
condition |
a character or numeric column in the |
grouping |
a character column in the |
intensity |
a numeric column in the |
ref_condition |
a character vector providing the condition that is used as a reference for
missingness determination. Instead of providing one reference condition, "all" can be supplied,
which will create all pairwise condition pairs. By default |
completeness_MAR |
a numeric value that specifies the minimal degree of data completeness to be considered as MAR. Value has to be between 0 and 1, default is 0.7. It is multiplied with the number of replicates and then adjusted downward. The resulting number is the minimal number of observations for each condition to be considered as MAR. This number is always at least 1. |
completeness_MNAR |
a numeric value that specifies the maximal degree of data completeness to be considered as MNAR. Value has to be between 0 and 1, default is 0.20. It is multiplied with the number of replicates and then adjusted downward. The resulting number is the maximal number of observations for one condition to be considered as MNAR when the other condition is complete. |
retain_columns |
a vector that indicates columns that should be retained from the input
data frame. Default is not retaining additional columns |
A data frame that contains the reference condition paired with each treatment condition.
The comparison column contains the comparison name for the specific treatment/reference
pair. The missingness column reports the type of missingness.
"complete": No missing values for every replicate of this reference/treatment pair for the specific grouping variable.
"MNAR": Missing not at random. All replicates of either the reference or treatment condition have missing values for the specific grouping variable.
"MAR": Missing at random. At least n-1 replicates have missing values for the reference/treatment pair for the specific grouping varible.
NA: The comparison is not complete enough to fall into any other category. It will not
be imputed if imputation is performed. For statistical significance testing these comparisons
are filtered out after the test and prior to p-value adjustment. This can be prevented by setting
filter_NA_missingness = FALSE in the calculate_diff_abundance() function.
The type of missingness has an influence on the way values are imputeted if imputation is
performed subsequently using the impute() function. How each type of missingness is
specifically imputed can be found in the function description. The type of missingness
assigned to a comparison does not have any influence on the statistical test in the
calculate_diff_abundance() function.
set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 10, frac_change = 0.5, n_replicates = 4, n_conditions = 2, method = "effect_random", additional_metadata = FALSE ) head(data, n = 24) # Assign missingness information data_missing <- assign_missingness( data, sample = sample, condition = condition, grouping = peptide, intensity = peptide_intensity_missing, ref_condition = "all", retain_columns = c(protein) ) head(data_missing, n = 24)set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 10, frac_change = 0.5, n_replicates = 4, n_conditions = 2, method = "effect_random", additional_metadata = FALSE ) head(data, n = 24) # Assign missingness information data_missing <- assign_missingness( data, sample = sample, condition = condition, grouping = peptide, intensity = peptide_intensity_missing, ref_condition = "all", retain_columns = c(protein) ) head(data_missing, n = 24)
Based on preceding and C-terminal amino acid, the peptide type of a given peptide is assigned. Peptides with preceeding and C-terminal lysine or arginine are considered fully-tryptic. If a peptide is located at the N- or C-terminus of a protein and fulfills the criterium to be fully-tryptic otherwise, it is also considered as fully-tryptic. Peptides that only fulfill the criterium on one terminus are semi-tryptic peptides. Lastly, peptides that are not fulfilling the criteria for both termini are non-tryptic peptides. In addition, peptides that miss the initial Methionine of a protein are considered "tryptic" at that site if there is no other peptide starting at position 1 for that protein.
assign_peptide_type( data, aa_before = aa_before, last_aa = last_aa, aa_after = aa_after, protein_id = NULL, start = start )assign_peptide_type( data, aa_before = aa_before, last_aa = last_aa, aa_after = aa_after, protein_id = NULL, start = start )
data |
a data frame containing at least information about the preceding and C-terminal amino acids of peptides. |
aa_before |
a character column in the |
last_aa |
a character column in the |
aa_after |
a character column in the |
protein_id |
a character column in the |
start |
a numeric column in the |
A data frame that contains the input data and an additional column with the peptide type information.
data <- data.frame( aa_before = c("K", "M", "", "M", "S", "M", "-"), last_aa = c("R", "K", "R", "R", "Y", "K", "K"), aa_after = c("T", "R", "T", "R", "T", "R", "T"), protein_id = c("P1", "P1", "P3", "P3", "P2", "P2", "P2"), start = c(38, 2, 1, 2, 10, 2, 1) ) assign_peptide_type(data, aa_before, last_aa, aa_after, protein_id, start)data <- data.frame( aa_before = c("K", "M", "", "M", "S", "M", "-"), last_aa = c("R", "K", "R", "R", "Y", "K", "K"), aa_after = c("T", "R", "T", "R", "T", "R", "T"), protein_id = c("P1", "P1", "P3", "P3", "P2", "P2", "P2"), start = c(38, 2, 1, 2, 10, 2, 1) ) assign_peptide_type(data, aa_before, last_aa, aa_after, protein_id, start)
Plots a "barcode plot" - a vertical line for each identified peptide. Peptides can be colored based on an additional variable. Also differential abundance can be displayed.
barcode_plot( data, start_position, end_position, protein_length, coverage = NULL, colouring = NULL, fill_colour_gradient = protti::mako_colours, fill_colour_discrete = c("#999999", protti::protti_colours), protein_id = NULL, facet = NULL, facet_n_col = 4, cutoffs = NULL )barcode_plot( data, start_position, end_position, protein_length, coverage = NULL, colouring = NULL, fill_colour_gradient = protti::mako_colours, fill_colour_discrete = c("#999999", protti::protti_colours), protein_id = NULL, facet = NULL, facet_n_col = 4, cutoffs = NULL )
data |
a data frame containing differential abundance, start and end peptide or precursor positions and protein length. |
start_position |
a numeric column in the data frame containing the start positions for each peptide or precursor. |
end_position |
a numeric column in the data frame containing the end positions for each peptide or precursor. |
protein_length |
a numeric column in the data frame containing the length of the protein. |
coverage |
optional, numeric column in the data frame containing coverage in percent. Will appear in the title of the barcode if provided. |
colouring |
optional, column in the data frame containing information by which peptide or precursors should be colored. |
fill_colour_gradient |
a vector that contains colours that should be used to create a colour gradient
for the barcode plot bars if the |
fill_colour_discrete |
a vector that contains colours that should be used to fill the barcode plot bars
if the |
protein_id |
optional, column in the data frame containing protein identifiers. Required if only one protein should be plotted and the data frame contains only information for this protein. |
facet |
optional, column in the data frame containing information by which data should be faceted. This can be protein identifiers. Only 20 proteins are plotted at a time, the rest is ignored. If more should be plotted, a mapper over a subsetted data frame should be created. |
facet_n_col |
a numeric value that specifies the number of columns the faceted plot should have if a column name is provided to group. The default is 4. |
cutoffs |
optional argument specifying the log2 fold change and significance cutoffs used for highlighting peptides. If this argument is provided colouring information will be overwritten with peptides that fulfill this condition. The cutoff should be provided in a vector of the form c(diff = 2, pval = 0.05). The name of the cutoff should reflect the column name that contains this information (log2 fold changes, p-values or adjusted p-values). |
A barcode plot is returned.
data <- data.frame( start = c(5, 40, 55, 130, 181, 195), end = c(11, 51, 60, 145, 187, 200), length = rep(200, 6), pg_protein_accessions = rep("Protein 1", 6), diff = c(1, 2, 5, 2, 1, 1), pval = c(0.1, 0.01, 0.01, 0.2, 0.2, 0.01) ) barcode_plot( data, start_position = start, end_position = end, protein_length = length, facet = pg_protein_accessions, cutoffs = c(diff = 2, pval = 0.05) )data <- data.frame( start = c(5, 40, 55, 130, 181, 195), end = c(11, 51, 60, 145, 187, 200), length = rep(200, 6), pg_protein_accessions = rep("Protein 1", 6), diff = c(1, 2, 5, 2, 1, 1), pval = c(0.1, 0.01, 0.01, 0.2, 0.2, 0.01) ) barcode_plot( data, start_position = start, end_position = end, protein_length = length, facet = pg_protein_accessions, cutoffs = c(diff = 2, pval = 0.05) )
Calculate a score for each amino acid position in a protein sequence based on the product of the
-log10(adjusted p-value) and the absolute log2(fold change) per peptide covering this amino acid. In detail, all the
peptides are aligned along the sequence of the corresponding protein, and the average score per
amino acid position is computed. In a limited proteolysis coupled to mass spectrometry (LiP-MS)
experiment, the score allows to prioritize and narrow down structurally affected regions.
calculate_aa_scores( data, protein, diff = diff, adj_pval = adj_pval, start_position, end_position, retain_columns = NULL )calculate_aa_scores( data, protein, diff = diff, adj_pval = adj_pval, start_position, end_position, retain_columns = NULL )
data |
a data frame containing at least the input columns. |
protein |
a character column in the data frame containing the protein identifier or name. |
diff |
a numeric column in the |
adj_pval |
a numeric column in the |
start_position |
a numeric column |
end_position |
a numeric column in the data frame containing the end position of a peptide or precursor. |
retain_columns |
a vector indicating if certain columns should be retained from the input
data frame. Default is not retaining additional columns |
A data frame that contains the aggregated scores per amino acid position, enabling to draw fingerprints for each individual protein.
Patrick Stalder
data <- data.frame( pg_protein_accessions = c(rep("protein_1", 10)), diff = c(2, -3, 1, 2, 3, -3, 5, 1, -0.5, 2), adj_pval = c(0.001, 0.01, 0.2, 0.05, 0.002, 0.5, 0.4, 0.7, 0.001, 0.02), start = c(1, 3, 5, 10, 15, 25, 28, 30, 41, 51), end = c(6, 8, 10, 16, 23, 35, 35, 35, 48, 55) ) calculate_aa_scores( data, protein = pg_protein_accessions, diff = diff, adj_pval = adj_pval, start_position = start, end_position = end )data <- data.frame( pg_protein_accessions = c(rep("protein_1", 10)), diff = c(2, -3, 1, 2, 3, -3, 5, 1, -0.5, 2), adj_pval = c(0.001, 0.01, 0.2, 0.05, 0.002, 0.5, 0.4, 0.7, 0.001, 0.02), start = c(1, 3, 5, 10, 15, 25, 28, 30, 41, 51), end = c(6, 8, 10, 16, 23, 35, 35, 35, 48, 55) ) calculate_aa_scores( data, protein = pg_protein_accessions, diff = diff, adj_pval = adj_pval, start_position = start, end_position = end )
Performs differential abundance calculations and statistical hypothesis tests on data frames with protein, peptide or precursor data. Different methods for statistical testing are available.
calculate_diff_abundance( data, sample, condition, grouping, intensity_log2, missingness = missingness, comparison = comparison, mean = NULL, sd = NULL, n_samples = NULL, ref_condition = "all", filter_NA_missingness = TRUE, method = c("moderated_t-test", "t-test", "t-test_mean_sd", "proDA"), p_adj_method = "BH", limma_legacy_estimation = NULL, retain_columns = NULL )calculate_diff_abundance( data, sample, condition, grouping, intensity_log2, missingness = missingness, comparison = comparison, mean = NULL, sd = NULL, n_samples = NULL, ref_condition = "all", filter_NA_missingness = TRUE, method = c("moderated_t-test", "t-test", "t-test_mean_sd", "proDA"), p_adj_method = "BH", limma_legacy_estimation = NULL, retain_columns = NULL )
data |
a data frame containing at least the input variables that are required for the
selected method. Ideally the output of |
sample |
a character column in the |
condition |
a character or numeric column in the |
grouping |
a character column in the |
intensity_log2 |
a numeric column in the |
missingness |
a character column in the |
comparison |
a character column in the |
mean |
a numeric column in the |
sd |
a numeric column in the |
n_samples |
a numeric column in the |
ref_condition |
optional, character value providing the condition that is used as a
reference for differential abundance calculation. Only required for |
filter_NA_missingness |
a logical value, default is |
method |
a character value, specifies the method used for statistical hypothesis testing.
Methods include Welch test ( |
p_adj_method |
a character value, specifies the p-value correction method. Possible
methods are c("holm", "hochberg", "hommel", "bonferroni", "BH", "BY", "fdr", "none"). Default
method is |
limma_legacy_estimation |
a logical value, specifying if the new or old hyperparameter
estimation of the limma package should be used. See the |
retain_columns |
a vector indicating if certain columns should be retained from the input
data frame. Default is not retaining additional columns |
A data frame that contains differential abundances (diff), p-values (pval)
and adjusted p-values (adj_pval) for each protein, peptide or precursor (depending on
the grouping variable) and the associated treatment/reference pair. Depending on the
method the data frame contains additional columns:
"t-test": The std_error column contains the standard error of the differential
abundances. n_obs contains the number of observations for the specific protein, peptide
or precursor (depending on the grouping variable) and the associated treatment/reference pair.
"t-test_mean_sd": Columns labeled as control refer to the second condition of the
comparison pairs. Treated refers to the first condition. mean_control and mean_treated
columns contain the means for the reference and treatment condition, respectively. sd_control
and sd_treated columns contain the standard deviations for the reference and treatment
condition, respectively. n_control and n_treated columns contain the numbers of
samples for the reference and treatment condition, respectively. The std_error column
contains the standard error of the differential abundances. t_statistic contains the
t_statistic for the t-test.
"moderated_t-test": CI_2.5 and CI_97.5 contain the 2.5% and 97.5%
confidence interval borders for differential abundances. avg_abundance contains average
abundances for treatment/reference pairs (mean of the two group means). t_statistic
contains the t_statistic for the t-test. B The B-statistic is the log-odds that the
protein, peptide or precursor (depending on grouping) has a differential abundance
between the two groups. Suppose B=1.5. The odds of differential abundance is exp(1.5)=4.48, i.e,
about four and a half to one. The probability that there is a differential abundance is
4.48/(1+4.48)=0.82, i.e., the probability is about 82% that this group is differentially
abundant. A B-statistic of zero corresponds to a 50-50 chance that the group is differentially
abundant.n_obs contains the number of observations for the specific protein, peptide or
precursor (depending on the grouping variable) and the associated treatment/reference pair.
"proDA": The std_error column contains the standard error of the differential
abundances. avg_abundance contains average abundances for treatment/reference pairs
(mean of the two group means). t_statistic contains the t_statistic for the t-test.
n_obs contains the number of observations for the specific protein, peptide or precursor
(depending on the grouping variable) and the associated treatment/reference pair.
For all methods execept "proDA", the p-value adjustment is performed only on the
proportion of data that contains a p-value that is not NA. For "proDA" the
p-value adjustment is either performed on the complete dataset (filter_NA_missingness = TRUE)
or on the subset of the dataset with missingness that is not NA (filter_NA_missingness = FALSE).
set.seed(123) # Makes example reproducible # Create synthetic data data <- create_synthetic_data( n_proteins = 10, frac_change = 0.5, n_replicates = 4, n_conditions = 2, method = "effect_random", additional_metadata = FALSE ) # Assign missingness information data_missing <- assign_missingness( data, sample = sample, condition = condition, grouping = peptide, intensity = peptide_intensity_missing, ref_condition = "all", retain_columns = c(protein, change_peptide) ) # Calculate differential abundances # Using "moderated_t-test" and "proDA" improves # true positive recovery progressively diff <- calculate_diff_abundance( data = data_missing, sample = sample, condition = condition, grouping = peptide, intensity_log2 = peptide_intensity_missing, missingness = missingness, comparison = comparison, method = "t-test", retain_columns = c(protein, change_peptide) ) head(diff, n = 10)set.seed(123) # Makes example reproducible # Create synthetic data data <- create_synthetic_data( n_proteins = 10, frac_change = 0.5, n_replicates = 4, n_conditions = 2, method = "effect_random", additional_metadata = FALSE ) # Assign missingness information data_missing <- assign_missingness( data, sample = sample, condition = condition, grouping = peptide, intensity = peptide_intensity_missing, ref_condition = "all", retain_columns = c(protein, change_peptide) ) # Calculate differential abundances # Using "moderated_t-test" and "proDA" improves # true positive recovery progressively diff <- calculate_diff_abundance( data = data_missing, sample = sample, condition = condition, grouping = peptide, intensity_log2 = peptide_intensity_missing, missingness = missingness, comparison = comparison, method = "t-test", retain_columns = c(protein, change_peptide) ) head(diff, n = 10)
Analyses enrichment of gene ontology terms associated with proteins in the fraction of
significant proteins compared to all detected proteins. A two-sided Fisher's exact test is
performed to test significance of enrichment or depletion. GO annotations can be provided to
this function either through UniProt go_annotations_uniprot, through a table obtained
with fetch_go in the go_data argument or GO annotations are fetched automatically
by the function by providing ontology_type and organism_id.
calculate_go_enrichment( data, protein_id, is_significant, group = NULL, y_axis_free = TRUE, facet_n_col = 2, go_annotations_uniprot = NULL, ontology_type, organism_id = NULL, go_data = NULL, plot = TRUE, plot_style = "barplot", plot_title = "Gene ontology enrichment of significant proteins", barplot_fill_colour = c("#56B4E9", "#E76145"), heatmap_fill_colour = protti::mako_colours, heatmap_fill_colour_rev = TRUE, label = TRUE, label_size = 7, enrichment_type = "all", replace_long_name = TRUE, label_move_frac = 0.2, min_n_detected_proteins_in_process = 1, plot_cutoff = "adj_pval top10" )calculate_go_enrichment( data, protein_id, is_significant, group = NULL, y_axis_free = TRUE, facet_n_col = 2, go_annotations_uniprot = NULL, ontology_type, organism_id = NULL, go_data = NULL, plot = TRUE, plot_style = "barplot", plot_title = "Gene ontology enrichment of significant proteins", barplot_fill_colour = c("#56B4E9", "#E76145"), heatmap_fill_colour = protti::mako_colours, heatmap_fill_colour_rev = TRUE, label = TRUE, label_size = 7, enrichment_type = "all", replace_long_name = TRUE, label_move_frac = 0.2, min_n_detected_proteins_in_process = 1, plot_cutoff = "adj_pval top10" )
data |
a data frame that contains at least the input variables. |
protein_id |
a character column in the |
is_significant |
a logical column in the |
group |
optional, character column in the |
y_axis_free |
a logical value that specifies if the y-axis of the plot should be "free"
for each facet if a grouping variable is provided. Default is |
facet_n_col |
a numeric value that specifies the number of columns the faceted plot should have if a column name is provided to group. The default is 2. |
go_annotations_uniprot |
recommended, a character column in the |
ontology_type |
optional, character value specifying the type of ontology that should
be used. Possible values are molecular function (MF), biological process (BP), cellular component
(CC). This argument is not required if GO annotations are provided from UniProt in
|
organism_id |
optional, character value specifying an NCBI taxonomy identifier of an
organism (TaxId). Possible inputs include only: "9606" (Human), "559292" (Yeast) and "83333"
(E. coli). Is only necessary if GO data is not provided either by |
go_data |
Optional, a data frame that can be obtained with |
plot |
a logical argument indicating whether the result should be plotted or returned as a table. |
plot_style |
a character argument that specifies the plot style. Can be either "barplot" (default)
or "heatmap". The "heatmap" plot is especially useful for the comparison of multiple groups. We recommend,
however, that you use it only with |
plot_title |
a character value that specifies the title of the plot. The default is "Gene ontology enrichment of significant proteins". |
barplot_fill_colour |
a vector that contains two colours that should be used as the fill colours for
deenriched and enriched GO terms, respectively. If |
heatmap_fill_colour |
a vector that contains colours that should be used to create the gradient in the
heatmap plot. Default is |
heatmap_fill_colour_rev |
a logical value that specifies if the provided colours in |
label |
a logical argument indicating whether labels should be added to the plot. Default is TRUE. |
label_size |
a numeric argument that specifies the text size of the labels with the unit "pt". The default is 7. |
enrichment_type |
a character argument that is either "all", "enriched" or "deenriched". This determines if the enrichment analysis should be performed in order to check for both enrichemnt and deenrichemnt or only one of the two. This affects the statistics performed and therefore also the displayed plot. |
replace_long_name |
a logical argument that specifies if GO term names above 50 characters should
be replaced by the GO ID instead for the plot. This ensures that the plotting area doesn't become
too small due to the long name. The default is |
label_move_frac |
a numeric argument between 0 and 1 that specifies which labels should be moved outside of the bar. The default is 0.2, which means that the labels of all bars that have a size of 20% or less of the largest bar are moved to the right of the bar. This prevents labels from overlapping with the bar boundaries. |
min_n_detected_proteins_in_process |
is a numeric argument that specifies the minimum number of
detected proteins required for a GO term to be displayed in the plot. The default is 1, meaning
no filtering of the plotted data is performed. This argument does not affect any computations or
the returned data if |
plot_cutoff |
a character value indicating if the plot should contain the top n (e.g. top10) most
significant proteins (p-value or adjusted p-value), or if a significance cutoff should be used
to determine the number of GO terms in the plot. This information should be provided with the
type first followed by the threshold separated by a space. Example are
|
A bar plot or heatmap (depending on plot_style). By default the bar plot displays negative log10
adjusted p-values for the top 10 enriched or deenriched gene ontology terms. Alternatively, plot cutoffs
can be chosen individually with the plot_cutoff argument. Bars are colored according to the direction
of the enrichment (enriched or deenriched). If a heatmap is returned, terms are organised on the y-axis, while
the colour of each tile represents the negative log10 adjusted p-value (default). If a group column
is provided the x-axis contains all groups. If plot = FALSE, a data frame is returned. P-values are adjusted with
Benjamini-Hochberg.
# Load libraries library(dplyr) library(stringr) # Create example data # Contains artificial de-enrichment for ribosomes. uniprot_go_data <- fetch_uniprot_proteome( organism_id = 83333, columns = c( "accession", "go_f" ) ) if (!is(uniprot_go_data, "character")) { data <- uniprot_go_data %>% mutate(significant = c( rep(TRUE, 1000), rep(FALSE, n() - 1000) )) %>% mutate(significant = ifelse( str_detect( go_f, pattern = "ribosome" ), FALSE, significant )) %>% mutate(group = c( rep("A", 500), rep("B", 500), rep("A", (n() - 1000) / 2), rep("B", round((n() - 1000) / 2)) )) # Plot gene ontology enrichment calculate_go_enrichment( data, protein_id = accession, go_annotations_uniprot = go_f, is_significant = significant, plot = TRUE, plot_cutoff = "pval 0.01" ) # Plot gene ontology enrichment with group calculate_go_enrichment( data, protein_id = accession, go_annotations_uniprot = go_f, is_significant = significant, group = group, facet_n_col = 1, plot = TRUE, plot_cutoff = "pval 0.01" ) # Plot gene ontology enrichment with group in a heatmap plot calculate_go_enrichment( data, protein_id = accession, group = group, go_annotations_uniprot = go_f, is_significant = significant, min_n_detected_proteins_in_process = 15, plot = TRUE, label = TRUE, plot_style = "heatmap", enrichment_type = "enriched", plot_cutoff = "pval 0.01" ) # Calculate gene ontology enrichment go_enrichment <- calculate_go_enrichment( data, protein_id = accession, go_annotations_uniprot = go_f, is_significant = significant, plot = FALSE, ) head(go_enrichment, n = 10) }# Load libraries library(dplyr) library(stringr) # Create example data # Contains artificial de-enrichment for ribosomes. uniprot_go_data <- fetch_uniprot_proteome( organism_id = 83333, columns = c( "accession", "go_f" ) ) if (!is(uniprot_go_data, "character")) { data <- uniprot_go_data %>% mutate(significant = c( rep(TRUE, 1000), rep(FALSE, n() - 1000) )) %>% mutate(significant = ifelse( str_detect( go_f, pattern = "ribosome" ), FALSE, significant )) %>% mutate(group = c( rep("A", 500), rep("B", 500), rep("A", (n() - 1000) / 2), rep("B", round((n() - 1000) / 2)) )) # Plot gene ontology enrichment calculate_go_enrichment( data, protein_id = accession, go_annotations_uniprot = go_f, is_significant = significant, plot = TRUE, plot_cutoff = "pval 0.01" ) # Plot gene ontology enrichment with group calculate_go_enrichment( data, protein_id = accession, go_annotations_uniprot = go_f, is_significant = significant, group = group, facet_n_col = 1, plot = TRUE, plot_cutoff = "pval 0.01" ) # Plot gene ontology enrichment with group in a heatmap plot calculate_go_enrichment( data, protein_id = accession, group = group, go_annotations_uniprot = go_f, is_significant = significant, min_n_detected_proteins_in_process = 15, plot = TRUE, label = TRUE, plot_style = "heatmap", enrichment_type = "enriched", plot_cutoff = "pval 0.01" ) # Calculate gene ontology enrichment go_enrichment <- calculate_go_enrichment( data, protein_id = accession, go_annotations_uniprot = go_f, is_significant = significant, plot = FALSE, ) head(go_enrichment, n = 10) }
calculate_imputation is a helper function that is used in the impute function.
Depending on the type of missingness and method, it samples values from a normal distribution
that can be used for the imputation. Note: The input intensities should be log2 transformed.
calculate_imputation( min = NULL, noise = NULL, mean = NULL, sd, missingness = c("MNAR", "MAR"), method = c("ludovic", "noise"), skip_log2_transform_error = FALSE )calculate_imputation( min = NULL, noise = NULL, mean = NULL, sd, missingness = c("MNAR", "MAR"), method = c("ludovic", "noise"), skip_log2_transform_error = FALSE )
min |
a numeric value specifying the minimal intensity value of the precursor/peptide.
Is only required if |
noise |
a numeric value specifying a noise value for the precursor/peptide. Is only
required if |
mean |
a numeric value specifying the mean intensity value of the condition with missing
values for a given precursor/peptide. Is only required if |
sd |
a numeric value specifying the mean of the standard deviation of all conditions for a given precursor/peptide. |
missingness |
a character value specifying the missingness type of the data determines
how values for imputation are sampled. This can be |
method |
a character value specifying the method to be used for imputation. For
|
skip_log2_transform_error |
a logical value, if FALSE a check is performed to validate that input values are log2 transformed. If input values are > 40 the test is failed and an error is returned. |
A value sampled from a normal distribution with the input parameters. Method specifics are applied to input parameters prior to sampling.
Analyses enrichment of KEGG pathways associated with proteins in the fraction of significant proteins compared to all detected proteins. A Fisher's exact test is performed to test significance of enrichment.
calculate_kegg_enrichment( data, protein_id, is_significant, pathway_id = pathway_id, pathway_name = pathway_name, plot = TRUE, plot_cutoff = "adj_pval top10" )calculate_kegg_enrichment( data, protein_id, is_significant, pathway_id = pathway_id, pathway_name = pathway_name, plot = TRUE, plot_cutoff = "adj_pval top10" )
data |
a data frame that contains at least the input variables. |
protein_id |
a character column in the |
is_significant |
a logical column in the |
pathway_id |
a character column in the |
pathway_name |
a character column in the |
plot |
a logical value indicating whether the result should be plotted or returned as a table. |
plot_cutoff |
a character value indicating if the plot should contain the top 10 most
significant proteins (p-value or adjusted p-value), or if a significance cutoff should be used
to determine the number of GO terms in the plot. This information should be provided with the
type first followed by the threshold separated by a space. Example are
|
A bar plot displaying negative log10 adjusted p-values for the top 10 enriched pathways.
Bars are coloured according to the direction of the enrichment. If plot = FALSE, a data
frame is returned.
# Load libraries library(dplyr) set.seed(123) # Makes example reproducible # Create example data kegg_data <- fetch_kegg(species = "eco") if (!is.null(kegg_data)) { # only proceed if information was retrieved data <- kegg_data %>% group_by(uniprot_id) %>% mutate(significant = rep( sample( x = c(TRUE, FALSE), size = 1, replace = TRUE, prob = c(0.2, 0.8) ), n = n() )) # Plot KEGG enrichment calculate_kegg_enrichment( data, protein_id = uniprot_id, is_significant = significant, pathway_id = pathway_id, pathway_name = pathway_name, plot = TRUE, plot_cutoff = "pval 0.05" ) # Calculate KEGG enrichment kegg <- calculate_kegg_enrichment( data, protein_id = uniprot_id, is_significant = significant, pathway_id = pathway_id, pathway_name = pathway_name, plot = FALSE ) head(kegg, n = 10) }# Load libraries library(dplyr) set.seed(123) # Makes example reproducible # Create example data kegg_data <- fetch_kegg(species = "eco") if (!is.null(kegg_data)) { # only proceed if information was retrieved data <- kegg_data %>% group_by(uniprot_id) %>% mutate(significant = rep( sample( x = c(TRUE, FALSE), size = 1, replace = TRUE, prob = c(0.2, 0.8) ), n = n() )) # Plot KEGG enrichment calculate_kegg_enrichment( data, protein_id = uniprot_id, is_significant = significant, pathway_id = pathway_id, pathway_name = pathway_name, plot = TRUE, plot_cutoff = "pval 0.05" ) # Calculate KEGG enrichment kegg <- calculate_kegg_enrichment( data, protein_id = uniprot_id, is_significant = significant, pathway_id = pathway_id, pathway_name = pathway_name, plot = FALSE ) head(kegg, n = 10) }
Determines relative protein abundances from ion quantification. Only proteins with at least three peptides are considered for quantification. The three peptide rule applies for each sample independently.
calculate_protein_abundance( data, sample, protein_id, precursor, peptide, intensity_log2, min_n_peptides = 3, method = "sum", for_plot = FALSE, retain_columns = NULL )calculate_protein_abundance( data, sample, protein_id, precursor, peptide, intensity_log2, min_n_peptides = 3, method = "sum", for_plot = FALSE, retain_columns = NULL )
data |
a data frame that contains at least the input variables. |
sample |
a character column in the |
protein_id |
a character column in the |
precursor |
a character column in the |
peptide |
a character column in the |
intensity_log2 |
a numeric column in the |
min_n_peptides |
An integer specifying the minimum number of peptides required for a protein to be included in the analysis. The default value is 3, which means proteins with fewer than three unique peptides will be excluded from the analysis. |
method |
a character value specifying with which method protein quantities should be
calculated. Possible options include |
for_plot |
a logical value indicating whether the result should be only protein intensities
or protein intensities together with precursor intensities that can be used for plotting using
|
retain_columns |
a vector indicating if certain columns should be retained from the input
data frame. Default is not retaining additional columns |
If for_plot = FALSE, protein abundances are returned, if for_plot = TRUE
also precursor intensities are returned in a data frame. The later output is ideal for plotting
with peptide_profile_plot() and can be filtered to only include protein abundances.
# Create example data data <- data.frame( sample = c( rep("S1", 6), rep("S2", 6), rep("S1", 2), rep("S2", 2) ), protein_id = c( rep("P1", 12), rep("P2", 4) ), precursor = c( rep(c("A1", "A2", "B1", "B2", "C1", "D1"), 2), rep(c("E1", "F1"), 2) ), peptide = c( rep(c("A", "A", "B", "B", "C", "D"), 2), rep(c("E", "F"), 2) ), intensity = c( rnorm(n = 6, mean = 15, sd = 2), rnorm(n = 6, mean = 21, sd = 1), rnorm(n = 2, mean = 15, sd = 1), rnorm(n = 2, mean = 15, sd = 2) ) ) data # Calculate protein abundances protein_abundance <- calculate_protein_abundance( data, sample = sample, protein_id = protein_id, precursor = precursor, peptide = peptide, intensity_log2 = intensity, method = "sum", for_plot = FALSE ) protein_abundance # Calculate protein abundances and retain precursor # abundances that can be used in a peptide profile plot complete_abundances <- calculate_protein_abundance( data, sample = sample, protein_id = protein_id, precursor = precursor, peptide = peptide, intensity_log2 = intensity, method = "sum", for_plot = TRUE ) complete_abundances# Create example data data <- data.frame( sample = c( rep("S1", 6), rep("S2", 6), rep("S1", 2), rep("S2", 2) ), protein_id = c( rep("P1", 12), rep("P2", 4) ), precursor = c( rep(c("A1", "A2", "B1", "B2", "C1", "D1"), 2), rep(c("E1", "F1"), 2) ), peptide = c( rep(c("A", "A", "B", "B", "C", "D"), 2), rep(c("E", "F"), 2) ), intensity = c( rnorm(n = 6, mean = 15, sd = 2), rnorm(n = 6, mean = 21, sd = 1), rnorm(n = 2, mean = 15, sd = 1), rnorm(n = 2, mean = 15, sd = 2) ) ) data # Calculate protein abundances protein_abundance <- calculate_protein_abundance( data, sample = sample, protein_id = protein_id, precursor = precursor, peptide = peptide, intensity_log2 = intensity, method = "sum", for_plot = FALSE ) protein_abundance # Calculate protein abundances and retain precursor # abundances that can be used in a peptide profile plot complete_abundances <- calculate_protein_abundance( data, sample = sample, protein_id = protein_id, precursor = precursor, peptide = peptide, intensity_log2 = intensity, method = "sum", for_plot = TRUE ) complete_abundances
Calculate sequence coverage for each identified protein.
calculate_sequence_coverage(data, protein_sequence, peptides)calculate_sequence_coverage(data, protein_sequence, peptides)
data |
a data frame containing at least the protein sequence and the identified peptides as columns. |
protein_sequence |
a character column in the |
peptides |
a character column in the |
A new column in the data data frame containing the calculated sequence coverage
for each identified protein
data <- data.frame( protein_sequence = c("abcdefghijklmnop", "abcdefghijklmnop"), pep_stripped_sequence = c("abc", "jklmn") ) calculate_sequence_coverage( data, protein_sequence = protein_sequence, peptides = pep_stripped_sequence )data <- data.frame( protein_sequence = c("abcdefghijklmnop", "abcdefghijklmnop"), pep_stripped_sequence = c("abc", "jklmn") ) calculate_sequence_coverage( data, protein_sequence = protein_sequence, peptides = pep_stripped_sequence )
Check for an enrichment of proteins interacting with the treatment in significantly changing proteins as compared to all proteins.
calculate_treatment_enrichment( data, protein_id, is_significant, binds_treatment, group = NULL, treatment_name, plot = TRUE, fill_colours = protti::protti_colours, fill_by_group = FALSE, facet_n_col = 2 )calculate_treatment_enrichment( data, protein_id, is_significant, binds_treatment, group = NULL, treatment_name, plot = TRUE, fill_colours = protti::protti_colours, fill_by_group = FALSE, facet_n_col = 2 )
data |
a data frame contains at least the input variables. |
protein_id |
a character column in the |
is_significant |
a logical column in the |
binds_treatment |
a logical column in the |
group |
optional, character column in the |
treatment_name |
a character value that indicates the treatment name. It will be included in the plot title. |
plot |
a logical value indicating whether the result should be plotted or returned as a table. |
fill_colours |
a character vector that specifies the fill colours of the plot. |
fill_by_group |
a logical value that specifies if the bars in the plot should be filled by group
if the group argument is provided. Default is |
facet_n_col |
a numeric value that specifies the number of columns the facet plot should have if
a |
A bar plot displaying the percentage of all detected proteins and all significant proteins
that bind to the treatment. A Fisher's exact test is performed to calculate the significance of
the enrichment in significant proteins compared to all proteins. The result is reported as a
p-value. If plot = FALSE a contingency table in long format is returned.
# Create example data data <- data.frame( protein_id = c(paste0("protein", 1:50)), significant = c( rep(TRUE, 20), rep(FALSE, 30) ), binds_treatment = c( rep(TRUE, 10), rep(FALSE, 10), rep(TRUE, 5), rep(FALSE, 25) ), group = c( rep("A", 5), rep("B", 15), rep("A", 15), rep("B", 15) ) ) # Plot treatment enrichment calculate_treatment_enrichment( data, protein_id = protein_id, is_significant = significant, binds_treatment = binds_treatment, treatment_name = "Rapamycin", plot = TRUE ) # Plot treatment enrichment by group calculate_treatment_enrichment( data, protein_id = protein_id, group = group, is_significant = significant, binds_treatment = binds_treatment, treatment_name = "Rapamycin", plot = TRUE, fill_by_group = TRUE ) # Calculate treatment enrichment enrichment <- calculate_treatment_enrichment( data, protein_id = protein_id, is_significant = significant, binds_treatment = binds_treatment, plot = FALSE ) enrichment# Create example data data <- data.frame( protein_id = c(paste0("protein", 1:50)), significant = c( rep(TRUE, 20), rep(FALSE, 30) ), binds_treatment = c( rep(TRUE, 10), rep(FALSE, 10), rep(TRUE, 5), rep(FALSE, 25) ), group = c( rep("A", 5), rep("B", 15), rep("A", 15), rep("B", 15) ) ) # Plot treatment enrichment calculate_treatment_enrichment( data, protein_id = protein_id, is_significant = significant, binds_treatment = binds_treatment, treatment_name = "Rapamycin", plot = TRUE ) # Plot treatment enrichment by group calculate_treatment_enrichment( data, protein_id = protein_id, group = group, is_significant = significant, binds_treatment = binds_treatment, treatment_name = "Rapamycin", plot = TRUE, fill_by_group = TRUE ) # Calculate treatment enrichment enrichment <- calculate_treatment_enrichment( data, protein_id = protein_id, is_significant = significant, binds_treatment = binds_treatment, plot = FALSE ) enrichment
Performs the correction of LiP-peptides for changes in protein abundance and calculates their significance using a t-test. This function was implemented based on the MSstatsLiP package developed by the Vitek lab.
correct_lip_for_abundance( lip_data, trp_data, protein_id, grouping, comparison = comparison, diff = diff, n_obs = n_obs, std_error = std_error, p_adj_method = "BH", retain_columns = NULL, method = c("satterthwaite", "no_df_approximation") )correct_lip_for_abundance( lip_data, trp_data, protein_id, grouping, comparison = comparison, diff = diff, n_obs = n_obs, std_error = std_error, p_adj_method = "BH", retain_columns = NULL, method = c("satterthwaite", "no_df_approximation") )
lip_data |
a data frame containing at least the input variables. Ideally,
the result from the |
trp_data |
a data frame containing at least the input variables minus the grouping column. Ideally,
the result from the |
protein_id |
a character column in the |
grouping |
a character column in the |
comparison |
a character column in the |
diff |
a numeric column in the |
n_obs |
a numeric column in the |
std_error |
a numeric column in the |
p_adj_method |
a character value, specifies the p-value correction method. Possible
methods are c("holm", "hochberg", "hommel", "bonferroni", "BH", "BY", "fdr", "none"). Default
method is |
retain_columns |
a vector indicating if certain columns should be retained from the input
data frame. Default is not retaining additional columns |
method |
a character value, specifies the method used to estimate the degrees of freedom.
Possible methods are c("satterthwaite", "no_df_approximation"). |
a data frame containing corrected differential abundances (adj_diff, adjusted
standard errors (adj_std_error), degrees of freedom (df), pvalues (pval) and
adjusted p-values (adj_pval)
Aaron Fehr
# Load libraries library(dplyr) # Load example data and simulate tryptic data by summing up precursors data <- rapamycin_10uM data_trp <- data %>% dplyr::group_by(pg_protein_accessions, r_file_name) %>% dplyr::mutate(pg_quantity = sum(fg_quantity)) %>% dplyr::distinct( r_condition, r_file_name, pg_protein_accessions, pg_quantity ) # Calculate differential abundances for LiP and Trp data diff_lip <- data %>% dplyr::mutate(fg_intensity_log2 = log2(fg_quantity)) %>% assign_missingness( sample = r_file_name, condition = r_condition, intensity = fg_intensity_log2, grouping = eg_precursor_id, ref_condition = "control", retain_columns = "pg_protein_accessions" ) %>% calculate_diff_abundance( sample = r_file_name, condition = r_condition, grouping = eg_precursor_id, intensity_log2 = fg_intensity_log2, comparison = comparison, method = "t-test", retain_columns = "pg_protein_accessions" ) diff_trp <- data_trp %>% dplyr::mutate(pg_intensity_log2 = log2(pg_quantity)) %>% assign_missingness( sample = r_file_name, condition = r_condition, intensity = pg_intensity_log2, grouping = pg_protein_accessions, ref_condition = "control" ) %>% calculate_diff_abundance( sample = r_file_name, condition = r_condition, grouping = pg_protein_accessions, intensity_log2 = pg_intensity_log2, comparison = comparison, method = "t-test" ) # Correct for abundance changes corrected <- correct_lip_for_abundance( lip_data = diff_lip, trp_data = diff_trp, protein_id = pg_protein_accessions, grouping = eg_precursor_id, retain_columns = c("missingness"), method = "satterthwaite" ) head(corrected, n = 10)# Load libraries library(dplyr) # Load example data and simulate tryptic data by summing up precursors data <- rapamycin_10uM data_trp <- data %>% dplyr::group_by(pg_protein_accessions, r_file_name) %>% dplyr::mutate(pg_quantity = sum(fg_quantity)) %>% dplyr::distinct( r_condition, r_file_name, pg_protein_accessions, pg_quantity ) # Calculate differential abundances for LiP and Trp data diff_lip <- data %>% dplyr::mutate(fg_intensity_log2 = log2(fg_quantity)) %>% assign_missingness( sample = r_file_name, condition = r_condition, intensity = fg_intensity_log2, grouping = eg_precursor_id, ref_condition = "control", retain_columns = "pg_protein_accessions" ) %>% calculate_diff_abundance( sample = r_file_name, condition = r_condition, grouping = eg_precursor_id, intensity_log2 = fg_intensity_log2, comparison = comparison, method = "t-test", retain_columns = "pg_protein_accessions" ) diff_trp <- data_trp %>% dplyr::mutate(pg_intensity_log2 = log2(pg_quantity)) %>% assign_missingness( sample = r_file_name, condition = r_condition, intensity = pg_intensity_log2, grouping = pg_protein_accessions, ref_condition = "control" ) %>% calculate_diff_abundance( sample = r_file_name, condition = r_condition, grouping = pg_protein_accessions, intensity_log2 = pg_intensity_log2, comparison = comparison, method = "t-test" ) # Correct for abundance changes corrected <- correct_lip_for_abundance( lip_data = diff_lip, trp_data = diff_trp, protein_id = pg_protein_accessions, grouping = eg_precursor_id, retain_columns = c("missingness"), method = "satterthwaite" ) head(corrected, n = 10)
This function creates a measurement queue for sample acquisition for the software Xcalibur.
All possible combinations of the provided information will be created to make file and
sample names.
create_queue( date = NULL, instrument = NULL, user = NULL, measurement_type = NULL, experiment_name = NULL, digestion = NULL, treatment_type_1 = NULL, treatment_type_2 = NULL, treatment_dose_1 = NULL, treatment_dose_2 = NULL, treatment_unit_1 = NULL, treatment_unit_2 = NULL, n_replicates = NULL, number_runs = FALSE, organism = NULL, exclude_combinations = NULL, inj_vol = NA, data_path = NA, method_path = NA, position_row = NA, position_column = NA, blank_every_n = NULL, blank_position = NA, blank_method_path = NA, blank_inj_vol = 1, export = FALSE, export_to_queue = FALSE, queue_path = NULL )create_queue( date = NULL, instrument = NULL, user = NULL, measurement_type = NULL, experiment_name = NULL, digestion = NULL, treatment_type_1 = NULL, treatment_type_2 = NULL, treatment_dose_1 = NULL, treatment_dose_2 = NULL, treatment_unit_1 = NULL, treatment_unit_2 = NULL, n_replicates = NULL, number_runs = FALSE, organism = NULL, exclude_combinations = NULL, inj_vol = NA, data_path = NA, method_path = NA, position_row = NA, position_column = NA, blank_every_n = NULL, blank_position = NA, blank_method_path = NA, blank_inj_vol = 1, export = FALSE, export_to_queue = FALSE, queue_path = NULL )
date |
optional, character value indicating the start date of the measurements. |
instrument |
optional, character value indicating the instrument initials. |
user |
optional, character value indicating the user name. |
measurement_type |
optional, character value indicating the measurement type of the samples (e.g "DIA", "DDA", "library" etc.). |
experiment_name |
optional, character value indicating the name of the experiment. |
digestion |
optional, character vector indicating the digestion types used in this experiment (e.g "LiP" and/or "tryptic control"). |
treatment_type_1 |
optional, character vector indicating the name of the treatment. |
treatment_type_2 |
optional, character vector indicating the name of a second treatment that was combined with the first treatment. |
treatment_dose_1 |
optional, numeric vector indicating the doses used for treatment 1. These can be concentrations or times etc. |
treatment_dose_2 |
optional, numeric vector indicating the doses used for treatment 2. These can be concentrations or times etc. |
treatment_unit_1 |
optional, character vector indicating the unit of the doses for treatment 1 (e.g min, mM, etc.). |
treatment_unit_2 |
optional, character vector indicating the unit of the doses for treatment 2 (e.g min, mM, etc.). |
n_replicates |
optional, a numeric value indicating the number of replicates used per sample. |
number_runs |
a logical that specifies if file names should be numbered from 1:n instead of adding experiment information. Default is FALSE. |
organism |
optional, character value indicating the name of the organism used. |
exclude_combinations |
optional, list of lists that contains vectors of treatment types and treatment doses of which combinations should be excluded from the final queue. |
inj_vol |
a numeric value indicating the volume used for injection in microliter. Will be
|
data_path |
a character value indicating the file path where the MS raw data should be saved.
Backslashes should be escaped by another backslash. Will be |
method_path |
a character value indicating the file path of the MS acquisition method.
Backslashes should be escaped by another backslash. Will be |
position_row |
a character vector that contains row positions that can be used for the samples (e.g c("A", "B")). If the number of specified rows and columns does not equal the total number of samples, positions will be repeated. |
position_column |
a character vector that contains column positions that can be used for the samples (e.g 8). If the number of specified rows and columns does not equal the total number of samples, positions will be repeated. |
blank_every_n |
optional, numeric value that specifies in which intervals a blank sample should be inserted. |
blank_position |
a character value that specifies the plate position of the blank. Will be
|
blank_method_path |
a character value that specifies the file path of the MS acquisition
method of the blank. Backslashes should be escaped by another backslash. Will be |
blank_inj_vol |
a numeric value that specifies the injection volume of the blank sample.
Will be |
export |
a logical value that specifies if the queue should be exported from R and saved
as a .csv file. Default is TRUE. Further options for export can be adjusted with the
|
export_to_queue |
a logical value that specifies if the resulting queue should be appended
to an already existing queue. If false result will be saved as |
queue_path |
optional, a character value that specifies the file path to a queue file to
which the generated queue should be appended if |
If export_to_queue = FALSE a file named queue.csv will be returned that
contains the generated queue. If export_to_queue = TRUE, the resulting generated queue
will be appended to an already existing queue that needs to be specified either interactively
or through the argument queue_path.
create_queue( date = c("200722"), instrument = c("EX1"), user = c("jquast"), measurement_type = c("DIA"), experiment_name = c("JPQ031"), digestion = c("LiP", "tryptic control"), treatment_type_1 = c("EDTA", "H2O"), treatment_type_2 = c("Zeba", "unfiltered"), treatment_dose_1 = c(10, 30, 60), treatment_unit_1 = c("min"), n_replicates = 4, number_runs = FALSE, organism = c("E. coli"), exclude_combinations = list(list( treatment_type_1 = c("H2O"), treatment_type_2 = c("Zeba", "unfiltered"), treatment_dose_1 = c(10, 30) )), inj_vol = c(2), data_path = "D:\\2007_Data", method_path = "C:\\Xcalibur\\methods\\DIA_120min", position_row = c("A", "B", "C", "D", "E", "F"), position_column = 8, blank_every_n = 4, blank_position = "1-V1", blank_method_path = "C:\\Xcalibur\\methods\\blank" )create_queue( date = c("200722"), instrument = c("EX1"), user = c("jquast"), measurement_type = c("DIA"), experiment_name = c("JPQ031"), digestion = c("LiP", "tryptic control"), treatment_type_1 = c("EDTA", "H2O"), treatment_type_2 = c("Zeba", "unfiltered"), treatment_dose_1 = c(10, 30, 60), treatment_unit_1 = c("min"), n_replicates = 4, number_runs = FALSE, organism = c("E. coli"), exclude_combinations = list(list( treatment_type_1 = c("H2O"), treatment_type_2 = c("Zeba", "unfiltered"), treatment_dose_1 = c(10, 30) )), inj_vol = c(2), data_path = "D:\\2007_Data", method_path = "C:\\Xcalibur\\methods\\DIA_120min", position_row = c("A", "B", "C", "D", "E", "F"), position_column = 8, blank_every_n = 4, blank_position = "1-V1", blank_method_path = "C:\\Xcalibur\\methods\\blank" )
Creates a contact map of a subset or of all atom or residue distances in a structure or
AlphaFold prediction file. Contact maps are a useful tool for the identification of protein
regions that are in close proximity in the folded protein. Additionally, regions that are
interacting closely with a small molecule or metal ion can be easily identified without the
need to open the structure in programs such as PyMOL or ChimeraX. For large datasets (more
than 40 contact maps) it is recommended to use the parallel_create_structure_contact_map()
function instead, regardless of if maps should be created in parallel or sequential.
create_structure_contact_map( data, data2 = NULL, id, chain = NULL, auth_seq_id = NULL, distance_cutoff = 10, pdb_model_number_selection = c(0, 1), return_min_residue_distance = TRUE, show_progress = TRUE, export = FALSE, export_location = NULL, structure_file = NULL )create_structure_contact_map( data, data2 = NULL, id, chain = NULL, auth_seq_id = NULL, distance_cutoff = 10, pdb_model_number_selection = c(0, 1), return_min_residue_distance = TRUE, show_progress = TRUE, export = FALSE, export_location = NULL, structure_file = NULL )
data |
a data frame containing at least a column with PDB ID information of which the name
can be provided to the |
data2 |
optional, a data frame that contains a subset of regions for which distances to regions
provided in the |
id |
a character column in the |
chain |
optional, a character column in the |
auth_seq_id |
optional, a character (or numeric) column in the |
distance_cutoff |
a numeric value specifying the distance cutoff in Angstrom. All values for pairwise comparisons are calculated but only values smaller than this cutoff will be returned in the output. If a cutoff of e.g. 5 is selected then only residues with a distance of 5 Angstrom and less are returned. Using a small value can reduce the size of the contact map drastically and is therefore recommended. The default value is 10. |
pdb_model_number_selection |
a numeric vector specifying which models from the structure files should be considered for contact maps. E.g. NMR models often have many models in one file. The default for this argument is c(0, 1). This means the first model of each structure file is selected for contact map calculations. For AlphaFold predictions the model number is 0 (only .pdb files), therefore this case is also included here. |
return_min_residue_distance |
a logical value that specifies if the contact map should be returned for all atom distances or the minimum residue distances. Minimum residue distances are smaller in size. If atom distances are not strictly needed it is recommended to set this argument to TRUE. The default is TRUE. |
show_progress |
a logical value that specifies if a progress bar will be shown (default is TRUE). |
export |
a logical value that indicates if contact maps should be exported as ".csv". The
name of the file will be the structure ID. Default is |
export_location |
optional, a character value that specifies the path to the location in
which the contact map should be saved if |
structure_file |
optional, a character value that specifies the path to the location and
name of a structure file in ".cif" or ".pdb" format for which a contact map should be created.
All other arguments can be provided as usual with the exception of the |
A list of contact maps for each PDB or UniProt ID provided in the input is returned.
If the export argument is TRUE, each contact map will be saved as a ".csv" file in the
current working directory or the location provided to the export_location argument.
# Create example data data <- data.frame( pdb_id = c("6NPF", "1C14", "3NIR"), chain = c("A", "A", NA), auth_seq_id = c("1;2;3;4;5;6;7", NA, NA) ) # Create contact map contact_maps <- create_structure_contact_map( data = data, id = pdb_id, chain = chain, auth_seq_id = auth_seq_id, return_min_residue_distance = TRUE ) str(contact_maps[["3NIR"]]) contact_maps# Create example data data <- data.frame( pdb_id = c("6NPF", "1C14", "3NIR"), chain = c("A", "A", NA), auth_seq_id = c("1;2;3;4;5;6;7", NA, NA) ) # Create contact map contact_maps <- create_structure_contact_map( data = data, id = pdb_id, chain = chain, auth_seq_id = auth_seq_id, return_min_residue_distance = TRUE ) str(contact_maps[["3NIR"]]) contact_maps
This function creates a synthetic limited proteolysis proteomics dataset that can be used to test functions while knowing the ground truth.
create_synthetic_data( n_proteins, frac_change, n_replicates, n_conditions, method = "effect_random", concentrations = NULL, median_offset_sd = 0.05, mean_protein_intensity = 16.88, sd_protein_intensity = 1.4, mean_n_peptides = 12.75, size_n_peptides = 0.9, mean_sd_peptides = 1.7, sd_sd_peptides = 0.75, mean_log_replicates = -2.2, sd_log_replicates = 1.05, effect_sd = 2, dropout_curve_inflection = 14, dropout_curve_sd = -1.2, additional_metadata = TRUE )create_synthetic_data( n_proteins, frac_change, n_replicates, n_conditions, method = "effect_random", concentrations = NULL, median_offset_sd = 0.05, mean_protein_intensity = 16.88, sd_protein_intensity = 1.4, mean_n_peptides = 12.75, size_n_peptides = 0.9, mean_sd_peptides = 1.7, sd_sd_peptides = 0.75, mean_log_replicates = -2.2, sd_log_replicates = 1.05, effect_sd = 2, dropout_curve_inflection = 14, dropout_curve_sd = -1.2, additional_metadata = TRUE )
n_proteins |
a numeric value that specifies the number of proteins in the synthetic dataset. |
frac_change |
a numeric value that specifies the fraction of proteins that has a peptide changing in abundance. So far only one peptide per protein is changing. |
n_replicates |
a numeric value that specifies the number of replicates per condition. |
n_conditions |
a numeric value that specifies the number of conditions. |
method |
a character value that specifies the method type for the random sampling of
significantly changing peptides. If |
concentrations |
a numeric vector of length equal to the number of conditions, only needs
to be specified if |
median_offset_sd |
a numeric value that specifies the standard deviation of normal distribution that is used for sampling of inter-sample-differences. Default is 0.05. |
mean_protein_intensity |
a numeric value that specifies the mean of the protein intensity distribution. Default: 16.8. |
sd_protein_intensity |
a numeric value that specifies the standard deviation of the protein intensity distribution. Default: 1.4. |
mean_n_peptides |
a numeric value that specifies the mean number of peptides per protein. Default: 12.75. |
size_n_peptides |
a numeric value that specifies the dispersion parameter (the shape
parameter of the gamma mixing distribution). Can be theoretically calculated as
|
mean_sd_peptides |
a numeric value that specifies the mean of peptide intensity standard deviations within a protein. Default: 1.7. |
sd_sd_peptides |
a numeric value that specifies the standard deviation of peptide intensity standard deviation within a protein. Default: 0.75. |
mean_log_replicates, sd_log_replicates
|
a numeric value that specifies the |
effect_sd |
a numeric value that specifies the standard deviation of a normal distribution
around |
dropout_curve_inflection |
a numeric value that specifies the intensity inflection point of a probabilistic dropout curve that is used to sample intensity dependent missing values. This argument determines how many missing values there are in the dataset. Default: 14. |
dropout_curve_sd |
a numeric value that specifies the standard deviation of the probabilistic dropout curve. Needs to be negative to sample a droupout towards low intensities. Default: -1.2. |
additional_metadata |
a logical value that determines if metadata such as protein coverage, missed cleavages and charge state should be sampled and added to the list. |
A data frame that contains complete peptide intensities and peptide intensities with values that were created based on a probabilistic dropout curve.
create_synthetic_data( n_proteins = 10, frac_change = 0.1, n_replicates = 3, n_conditions = 2 ) # determination of mean_n_peptides and size_n_peptides parameters based on real data (count) # example peptide count per protein count <- c(6, 3, 2, 0, 1, 0, 1, 2, 2, 0) theta <- c(mu = 1, k = 1) negbinom <- function(theta) { -sum(stats::dnbinom(count, mu = theta[1], size = theta[2], log = TRUE)) } fit <- stats::optim(theta, negbinom) fit # determination of mean_log_replicates and sd_log_replicates parameters # based on real data (standard_deviations) # example standard deviations of replicates standard_deviations <- c(0.61, 0.54, 0.2, 1.2, 0.8, 0.3, 0.2, 0.6) theta2 <- c(meanlog = 1, sdlog = 1) lognorm <- function(theta2) { -sum(stats::dlnorm(standard_deviations, meanlog = theta2[1], sdlog = theta2[2], log = TRUE)) } fit2 <- stats::optim(theta2, lognorm) fit2create_synthetic_data( n_proteins = 10, frac_change = 0.1, n_replicates = 3, n_conditions = 2 ) # determination of mean_n_peptides and size_n_peptides parameters based on real data (count) # example peptide count per protein count <- c(6, 3, 2, 0, 1, 0, 1, 2, 2, 0) theta <- c(mu = 1, k = 1) negbinom <- function(theta) { -sum(stats::dnbinom(count, mu = theta[1], size = theta[2], log = TRUE)) } fit <- stats::optim(theta, negbinom) fit # determination of mean_log_replicates and sd_log_replicates parameters # based on real data (standard_deviations) # example standard deviations of replicates standard_deviations <- c(0.61, 0.54, 0.2, 1.2, 0.8, 0.3, 0.2, 0.6) theta2 <- c(meanlog = 1, sdlog = 1) lognorm <- function(theta2) { -sum(stats::dlnorm(standard_deviations, meanlog = theta2[1], sdlog = theta2[2], log = TRUE)) } fit2 <- stats::optim(theta2, lognorm) fit2
This function peforms the four-parameter dose response curve fit. It is the helper function
for the fit in the fit_drc_4p function.
drc_4p(data, response, dose, log_logarithmic = TRUE, pb = NULL)drc_4p(data, response, dose, log_logarithmic = TRUE, pb = NULL)
data |
a data frame that contains at least the dose and response column the model should be fitted to. |
response |
a numeric column that contains the response values. |
dose |
a numeric column that contains the dose values. |
log_logarithmic |
a logical value indicating if a logarithmic or log-logarithmic model is fitted. If response values form a symmetric curve for non-log transformed dose values, a logarithmic model instead of a log-logarithmic model should be used. Usually biological dose response data has a log-logarithmic distribution, which is the reason this is the default. Log-logarithmic models are symmetric if dose values are log transformed. |
pb |
progress bar object. This is only necessary if the function is used in an iteration. |
An object of class drc. If no fit was performed a character vector with content
"no_fit".
Function for plotting four-parameter dose response curves for each group (precursor, peptide or
protein), based on output from fit_drc_4p function.
drc_4p_plot( data, grouping, response, dose, targets, unit = "uM", y_axis_name = "Response", facet_title_size = 15, facet = TRUE, scales = "free", x_axis_scale_log10 = TRUE, x_axis_limits = c(NA, NA), colours = NULL, export = FALSE, export_height = 25, export_width = 30, export_name = "dose-response_curves" )drc_4p_plot( data, grouping, response, dose, targets, unit = "uM", y_axis_name = "Response", facet_title_size = 15, facet = TRUE, scales = "free", x_axis_scale_log10 = TRUE, x_axis_limits = c(NA, NA), colours = NULL, export = FALSE, export_height = 25, export_width = 30, export_name = "dose-response_curves" )
data |
a data frame that is obtained by calling the |
grouping |
a character column in the |
response |
a numeric column in a nested data frame called |
dose |
a numeric column in a nested data frame called |
targets |
a character vector that specifies the names of the precursors, peptides or
proteins (depending on |
unit |
a character value specifying the unit of the concentration. |
y_axis_name |
a character value specifying the name of the y-axis of the plot. |
facet_title_size |
a numeric value that specifies the size of the facet title. Default is 15. |
facet |
a logical value that indicates if plots should be summarised into facets of 20 plots. This is recommended for many plots. |
scales |
a character value that specifies if the scales in faceted plots (if more than one
target was provided) should be |
x_axis_scale_log10 |
a logical value that indicates if the x-axis scale should be log10 transformed. |
x_axis_limits |
a numeric vector of length 2, defining the lower and upper x-axis limit. The
default is |
colours |
a character vector containing at least three colours. The first is used for the points, the second for the confidence interval and the third for the curve. By default the first two protti colours are used for the points and confidence interval and the curve is black. |
export |
a logical value that indicates if plots should be exported as PDF. The output
directory will be the current working directory. The name of the file can be chosen using the
|
export_height |
a numeric value that specifies the plot height in inches for an exported plot.
The default is |
export_width |
a numeric value that specifies the plot height in inches for an exported plot.
The default is |
export_name |
a character value providing the name of the exported file if
|
If targets = "all" a list containing plots for every unique identifier in the
grouping variable is created. Otherwise a plot for the specified targets is created with
maximally 20 facets.
set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 2, frac_change = 1, n_replicates = 3, n_conditions = 8, method = "dose_response", concentrations = c(0, 1, 10, 50, 100, 500, 1000, 5000), additional_metadata = FALSE ) # Perform dose response curve fit drc_fit <- fit_drc_4p( data = data, sample = sample, grouping = peptide, response = peptide_intensity_missing, dose = concentration, retain_columns = c(protein) ) str(drc_fit) # Plot dose response curves if (!is.null(drc_fit)) { drc_4p_plot( data = drc_fit, grouping = peptide, response = peptide_intensity_missing, dose = concentration, targets = c("peptide_2_1", "peptide_2_3"), unit = "pM" ) }set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 2, frac_change = 1, n_replicates = 3, n_conditions = 8, method = "dose_response", concentrations = c(0, 1, 10, 50, 100, 500, 1000, 5000), additional_metadata = FALSE ) # Perform dose response curve fit drc_fit <- fit_drc_4p( data = data, sample = sample, grouping = peptide, response = peptide_intensity_missing, dose = concentration, retain_columns = c(protein) ) str(drc_fit) # Plot dose response curves if (!is.null(drc_fit)) { drc_4p_plot( data = drc_fit, grouping = peptide, response = peptide_intensity_missing, dose = concentration, targets = c("peptide_2_1", "peptide_2_3"), unit = "pM" ) }
Information of metal binding proteins is extracted from UniProt data retrieved with
fetch_uniprot as well as QuickGO data retrieved with fetch_quickgo.
extract_metal_binders( data_uniprot, data_quickgo, data_chebi = NULL, data_chebi_relation = NULL, data_eco = NULL, data_eco_relation = NULL, show_progress = TRUE )extract_metal_binders( data_uniprot, data_quickgo, data_chebi = NULL, data_chebi_relation = NULL, data_eco = NULL, data_eco_relation = NULL, show_progress = TRUE )
data_uniprot |
a data frame containing at least the |
data_quickgo |
a data frame containing molecular function gene ontology information for at
least the proteins of interest. This data should be obtained by calling |
data_chebi |
optional, a data frame that can be manually obtained with |
data_chebi_relation |
optional, a data frame that can be manually obtained with
|
data_eco |
optional, a data frame that contains evidence and conclusion ontology data that can be
obtained by calling |
data_eco_relation |
optional, a data frame that contains relational evidence and conclusion
ontology data that can be obtained by calling |
show_progress |
a logical value that specifies if progress will be shown (default is TRUE). |
A data frame containing information on protein metal binding state. It contains the following columns:
accession: UniProt protein identifier.
most_specific_id: ChEBI ID that is most specific for the position after combining information from all sources.
Can be multiple IDs separated by "," if a position appears multiple times due to multiple fitting IDs.
most_specific_id_name: The name of the ID in the most_specific_id column. This information is based on
ChEBI.
ligand_identifier: A ligand identifier that is unique per ligand per protein. It consists of the ligand ID and
ligand name. The ligand ID counts the number of ligands of the same type per protein.
ligand_position: The amino acid position of the residue interacting with the ligand.
binding_mode: Contains information about the way the amino acid residue interacts with the ligand. If it is
"covalent" then the residue is not in contact with the metal directly but only the cofactor that binds the metal.
metal_function: Contains information about the function of the metal. E.g. "catalytic".
metal_id_part: Contains a ChEBI ID that identifies the metal part of the ligand. This is always the metal atom.
metal_id_part_name: The name of the ID in the metal_id_part column. This information is based on
ChEBI.
note: Contains notes associated with information based on cofactors.
chebi_id: Contains the original ChEBI IDs the information is based on.
source: Contains the sources of the information. This can consist of "binding", "cofactor", "catalytic_activity",
"Keyword" and "go_term".
eco: If there is evidence the annotation is based on it is annotated with an ECO ID, which is split by source.
eco_type: The ECO identifier can fall into the "manual_assertion" group for manually curated annotations or the
"automatic_assertion" group for automatically generated annotations. If there is no evidence it is annotated as
"automatic_assertion". The information is split by source.
evidence_source: The original sources (e.g. literature, PDB) of evidence annotations split by source.
reaction: Contains information about the chemical reaction catalysed by the protein that involves the metal.
Can contain the EC ID, Rhea ID, direction specific Rhea ID, direction of the reaction and evidence for the direction.
go_term: Contains gene ontology terms if there are any metal related ones associated with the annotation.
go_name: Contains gene ontology names if there are any metal related ones associated with the annotation.
assigned_by: Contains information about the source of the gene ontology term assignment.
database: Contains information about the source of the ChEBI annotation associated with gene ontology terms.
keyword: Contains keywords if they were annotated in UniProt.
For each protein identifier the data frame contains information on the bound ligand as well as on its position if it is known.
Since information about metal ligands can come from multiple sources, additional information (e.g. evidence) is nested in the returned
data frame. In order to unnest the relevant information the following steps have to be taken: It is
possible that there are multiple IDs in the "most_specific_id" column. This means that one position cannot be uniquely
attributed to one specific ligand even with the same ligand_identifier. Apart from the "most_specific_id" column, in
which those instances are separated by ",", in other columns the relevant information is separated by "||". Then
information should be split based on the source (not the source column, that one can be removed from the data
frame). There are certain columns associated with specific sources (e.g. go_term is associated
with the "go_term" source). Values of columns not relevant for a certain source should be replaced with NA.
Since a most_specific_id can have multiple chebi_ids associated with it we need to unnest the chebi_id
column and associated columns in which information is separated by "|". Afterwards evidence and additional information can be
unnested by first splitting data for ";;" and then for ";". If the "metal_id_part_name" column contains an NA value the indicated
ligand position does not directly contact the metal ion. This is usually the case for ligands such as e.g. heme.
# Create example data uniprot_ids <- c("P00393", "P06129", "A0A0C5Q309", "A0A0C9VD04") ## UniProt data data_uniprot <- fetch_uniprot( uniprot_ids = uniprot_ids, columns = c( "ft_binding", "cc_cofactor", "cc_catalytic_activity", "keyword" ) ) ## QuickGO data data_quickgo <- fetch_quickgo( id_annotations = uniprot_ids, ontology_annotations = "molecular_function" ) ## ChEBI data (2 and 3 star entries) data_chebi <- fetch_chebi(stars = c(2, 3)) data_chebi_relation <- fetch_chebi(relation = TRUE) ## ECO data eco <- fetch_eco() eco_relation <- fetch_eco(return_relation = TRUE) # Extract metal binding information metal_info <- extract_metal_binders( data_uniprot = data_uniprot, data_quickgo = data_quickgo, data_chebi = data_chebi, data_chebi_relation = data_chebi_relation, data_eco = eco, data_eco_relation = eco_relation ) metal_info# Create example data uniprot_ids <- c("P00393", "P06129", "A0A0C5Q309", "A0A0C9VD04") ## UniProt data data_uniprot <- fetch_uniprot( uniprot_ids = uniprot_ids, columns = c( "ft_binding", "cc_cofactor", "cc_catalytic_activity", "keyword" ) ) ## QuickGO data data_quickgo <- fetch_quickgo( id_annotations = uniprot_ids, ontology_annotations = "molecular_function" ) ## ChEBI data (2 and 3 star entries) data_chebi <- fetch_chebi(stars = c(2, 3)) data_chebi_relation <- fetch_chebi(relation = TRUE) ## ECO data eco <- fetch_eco() eco_relation <- fetch_eco(return_relation = TRUE) # Extract metal binding information metal_info <- extract_metal_binders( data_uniprot = data_uniprot, data_quickgo = data_quickgo, data_chebi = data_chebi, data_chebi_relation = data_chebi_relation, data_eco = eco, data_eco_relation = eco_relation ) metal_info
Fetches the aligned error for AlphaFold predictions for provided proteins. The aligned error is useful for assessing inter-domain accuracy. In detail it represents the expected position error at residue x (scored residue), when the predicted and true structures are aligned on residue y (aligned residue).
fetch_alphafold_aligned_error( uniprot_ids = NULL, error_cutoff = 20, timeout = 30, max_tries = 1, version = "v6", return_data_frame = FALSE, show_progress = TRUE )fetch_alphafold_aligned_error( uniprot_ids = NULL, error_cutoff = 20, timeout = 30, max_tries = 1, version = "v6", return_data_frame = FALSE, show_progress = TRUE )
uniprot_ids |
a character vector of UniProt identifiers for which predictions should be fetched. |
error_cutoff |
a numeric value specifying the maximum position error (in Angstroms) that should be retained. setting this value to a low number reduces the size of the retrieved data. Default is 20. |
timeout |
a numeric value specifying the time in seconds until the download times out. The default is 30 seconds. |
max_tries |
a numeric value that specifies the number of times the function tries to download the data in case an error occurs. The default is 1. |
version |
a character value that specifies the alphafold version that should be used. This is regularly updated by the database. We always try to make the current version the default version. Available version can be found here: https://ftp.ebi.ac.uk/pub/databases/alphafold/ |
return_data_frame |
a logical value; if |
show_progress |
a logical value; if |
A list that contains aligned errors for AlphaFold predictions. If return_data_frame is TRUE, a data frame with this information is returned instead. The data frame contains the following columns:
scored_residue: The error for this position is calculated based on the alignment to the aligned residue.
aligned_residue: The residue that is aligned for the calculation of the error of the scored residue
error: The predicted aligned error computed by alpha fold.
accession: The UniProt protein identifier.
aligned_error <- fetch_alphafold_aligned_error( uniprot_ids = c("F4HVG8", "O15552"), error_cutoff = 5, return_data_frame = TRUE ) head(aligned_error, n = 10)aligned_error <- fetch_alphafold_aligned_error( uniprot_ids = c("F4HVG8", "O15552"), error_cutoff = 5, return_data_frame = TRUE ) head(aligned_error, n = 10)
Fetches atom level data for AlphaFold predictions either for selected proteins or whole organisms.
fetch_alphafold_prediction( uniprot_ids = NULL, organism_name = NULL, version = "v6", timeout = 3600, max_tries = 5, return_data_frame = FALSE, show_progress = TRUE )fetch_alphafold_prediction( uniprot_ids = NULL, organism_name = NULL, version = "v6", timeout = 3600, max_tries = 5, return_data_frame = FALSE, show_progress = TRUE )
uniprot_ids |
optional, a character vector of UniProt identifiers for which predictions
should be fetched. This argument is mutually exclusive to the |
organism_name |
optional, a character value providing the name of an organism for which
all available AlphaFold predictions should be retreived. The name should be the capitalised
scientific species name (e.g. "Homo sapiens"). Note: Some organisms contain a lot of
predictions which might take a considerable amount of time and memory to fetch. Therefore, you
should be sure that your system can handle fetching predictions for these organisms. This
argument is mutually exclusive to the |
version |
a character value that specifies the alphafold version that should be used. This is regularly updated by the database. We always try to make the current version the default version. Available version can be found here: https://ftp.ebi.ac.uk/pub/databases/alphafold/ |
timeout |
a numeric value specifying the time in seconds until the download of an organism archive times out. The default is 3600 seconds. |
max_tries |
a numeric value that specifies the number of times the function tries to download
the data in case an error occurs. The default is 5. This only applies if |
return_data_frame |
a logical value that specifies if true, a data frame instead of a list is returned. It is recommended to only use this if information for few proteins is retrieved. Default is FALSE. |
show_progress |
a logical value that specifies if true, a progress bar will be shown. Default is TRUE. |
A list that contains atom level data for AlphaFold predictions. If return_data_frame is TRUE, a data frame with this information is returned instead. The data frame contains the following columns:
label_id: Uniquely identifies every atom in the prediction following the standardised convention for mmCIF files.
type_symbol: The code used to identify the atom species representing this atom type. This code is the element symbol.
label_atom_id: Uniquely identifies every atom for the given residue following the standardised convention for mmCIF files.
label_comp_id: A chemical identifier for the residue. This is the three- letter code for the amino acid.
label_asym_id: Chain identifier following the standardised convention for mmCIF files. Since every prediction only contains one protein this is always "A".
label_seq_id: Uniquely and sequentially identifies residues for each protein. The numbering corresponds to the UniProt amino acid positions.
x: The x coordinate of the atom.
y: The y coordinate of the atom.
z: The z coordinate of the atom.
prediction_score: Contains the prediction score for each residue.
auth_seq_id: Same as label_seq_id. But of type character.
auth_comp_id: Same as label_comp_id.
auth_asym_id: Same as label_asym_id.
uniprot_id: The UniProt identifier of the predicted protein.
score_quality: Score annotations.
alphafold <- fetch_alphafold_prediction( uniprot_ids = c("F4HVG8", "O15552"), return_data_frame = TRUE ) head(alphafold, n = 10)alphafold <- fetch_alphafold_prediction( uniprot_ids = c("F4HVG8", "O15552"), return_data_frame = TRUE ) head(alphafold, n = 10)
Fetches information from the ChEBI database.
fetch_chebi(relation = FALSE, stars = c(3), timeout = 60)fetch_chebi(relation = FALSE, stars = c(3), timeout = 60)
relation |
a logical value that indicates if ChEBI Ontology data will be returned instead the main compound data. This data can be used to check the relations of ChEBI ID's to each other. Default is FALSE. |
stars |
a numeric vector indicating the "star" level (confidence) for which entries should
be retrieved (Possible levels are 1, 2 and 3). Default is |
timeout |
a numeric value specifying the time in seconds until the download of an organism archive times out. The default is 60 seconds. |
A data frame that contains information about each molecule in the ChEBI database.
chebi <- fetch_chebi() head(chebi)chebi <- fetch_chebi() head(chebi)
Fetches all evidence & conclusion ontology (ECO) information from the QuickGO EBI database. The ECO project is maintained through a public GitHub repository.
fetch_eco( return_relation = FALSE, return_history = FALSE, show_progress = TRUE )fetch_eco( return_relation = FALSE, return_history = FALSE, show_progress = TRUE )
return_relation |
a logical value that indicates if relational information should be returned instead the main descriptive information. This data can be used to check the relations of ECO terms to each other. Default is FALSE. |
return_history |
a logical value that indicates if the entry history of an ECO term should be returned instead the main descriptive information. Default is FALSE. |
show_progress |
a logical value that indicates if a progress bar will be shown. Default is TRUE. |
According to the GitHub repository ECO is defined as follows:
"The Evidence & Conclusion Ontology (ECO) describes types of scientific evidence within the biological research domain that arise from laboratory experiments, computational methods, literature curation, or other means. Researchers use evidence to support conclusions that arise out of scientific research. Documenting evidence during scientific research is essential, because evidence gives us a sense of why we believe what we think we know. Conclusions are asserted as statements about things that are believed to be true, for example that a protein has a particular function (i.e. a protein functional annotation) or that a disease is associated with a particular gene variant (i.e. a phenotype-gene association). A systematic and structured (i.e. ontological) classification of evidence allows us to store, retreive, share, and compare data associated with that evidence using computers, which are essential to navigating the ever-growing (in size and complexity) corpus of scientific information."
More information can be found in their publication (doi:10.1093/nar/gky1036).
A data frame that contains descriptive information about each ECO term in the EBI database.
If either return_relation or return_history is set to TRUE, the respective information is
returned instead of the usual output.
eco <- fetch_eco() head(eco)eco <- fetch_eco() head(eco)
Fetches gene ontology data from geneontology.org for the provided organism ID.
fetch_go(organism_id)fetch_go(organism_id)
organism_id |
a character value NCBI taxonomy identifier of an organism (TaxId). Possible inputs inlude only: "9606" (Human), "559292" (Yeast) and "83333" (E. coli). |
A data frame that contains gene ontology mappings to UniProt or SGD IDs. The original file is a .GAF file. A detailed description of all columns can be found here: http://geneontology.org/docs/go-annotation-file-gaf-format-2.1/
go <- fetch_go("9606") head(go)go <- fetch_go("9606") head(go)
Fetches either domain level information with e.g. gene ontology annotations or residue level information from the InterPro database.
fetch_interpro( uniprot_ids = NULL, return_residue_info = FALSE, manual_query = NULL, page_size = 200, max_tries = 3, timeout = 20, show_progress = TRUE )fetch_interpro( uniprot_ids = NULL, return_residue_info = FALSE, manual_query = NULL, page_size = 200, max_tries = 3, timeout = 20, show_progress = TRUE )
uniprot_ids |
a character vector of UniProt accession numbers. |
return_residue_info |
a logical value that specifies if either domain or residue information
should be returned by the function. The default is |
manual_query |
optional, a character value that is a custom query to the InterPro database. This query is pastes after "https://www.ebi.ac.uk/interpro/api/" and before "&page_size=200". The raw data of the query is returned as a list. |
page_size |
a numeric value that specifies the number of entries that should be retrieved per page of a request. The function anyway iterates through all pages, but this parameters allows you to finetune the number of iterations and thus number of requests to the database. Default is 200. |
max_tries |
a numeric value that specifies the number of times the function tries to download the data in case an error occurs. The default is 3. |
timeout |
a numeric value that specifies the maximum request time per try. Default is 20 seconds. |
show_progress |
a logical value that determines if a progress bar will be shown. Default is TRUE. |
A data frame that contains either domain or residue level information for the provided UniProt IDs.
uniprot_ids <- c("P36578", "O43324", "Q00796", "O32583") domain_info <- fetch_interpro(uniprot_ids = uniprot_ids) head(domain_info) residue_info <- fetch_interpro( uniprot_ids = uniprot_ids, return_residue_info = TRUE ) head(residue_info)uniprot_ids <- c("P36578", "O43324", "Q00796", "O32583") domain_info <- fetch_interpro(uniprot_ids = uniprot_ids) head(domain_info) residue_info <- fetch_interpro( uniprot_ids = uniprot_ids, return_residue_info = TRUE ) head(residue_info)
Fetches gene IDs and corresponding pathway IDs and names for the provided organism.
fetch_kegg(species)fetch_kegg(species)
species |
a character value providing an abreviated species name. "hsa" for human, "eco" for E. coli and "sce" for S. cerevisiae. Additional possible names can be found for eukaryotes and for prokaryotes. |
A data frame that contains gene IDs with corresponding pathway IDs and names for a selected organism.
kegg <- fetch_kegg(species = "hsa") head(kegg)kegg <- fetch_kegg(species = "hsa") head(kegg)
Fetches information about protein-metal binding sites from the MetalPDB database. A complete list of different possible search queries can be found on their website.
fetch_metal_pdb( id_type = "uniprot", id_value, site_type = NULL, pfam = NULL, cath = NULL, scop = NULL, representative = NULL, metal = NULL, ligands = NULL, geometry = NULL, coordination = NULL, donors = NULL, columns = NULL, show_progress = TRUE )fetch_metal_pdb( id_type = "uniprot", id_value, site_type = NULL, pfam = NULL, cath = NULL, scop = NULL, representative = NULL, metal = NULL, ligands = NULL, geometry = NULL, coordination = NULL, donors = NULL, columns = NULL, show_progress = TRUE )
id_type |
a character value that specifies the type of the IDs provided to |
id_value |
a character vector supplying IDs that are of the ID type that was specified in
|
site_type |
optional, a character value that specifies a nuclearity for which information should be retrieved. The specific nuclearity can be supplied as e.g. "tetranuclear". |
pfam |
optional, a character value that specifies a Pfam domain for which information should be retrieved. The domain can be specified as e.g. "Carb_anhydrase". |
cath |
optional, a character value that specifies a CATH ID for which information should be retrieved. The ID can be specified as e.g. "3.10.200.10". |
scop |
optional, a character value that specifies a SCOP ID for which information should be retrieved. The ID can be specified as e.g. "b.74.1.1". |
representative |
optional, a logical that indicates if only information of representative
sites of a family should be retrieved it can be specified here. A representative site is a
site selected to represent a cluster of equivalent sites. The selection is done by choosing
the PDB structure with the best X-ray resolution among those containing the sites in the
cluster. NMR structures are generally discarded in favor of X-ray structures, unless all the
sites in the cluster are found in NMR structures. If it is |
metal |
optional, a character value that specifies a metal for which information should be retrieved. The metal can be specified as e.g. "Zn". |
ligands |
optional, a character value that specifies a metal ligand residue for which information should be retrieved. The ligand can be specified as e.g. "His". |
geometry |
optional, a character value that specifies a metal site geometry for which information should be retrieved. The geometry can be specified here based on the three letter code for geometries provided on their website. |
coordination |
optional, a character value that specifies a coordination number for which information should be retrieved. The number can be specified as e.g. "3". |
donors |
optional, a character value that specifies a metal ligand atom for which information should be retrieved. The atom can be specified as e.g. "S" for sulfur. |
columns |
optional, a character vector that specifies specific columns that should be retrieved based on the MetalPDB website. If nothing is supplied here, all possible columns will be retrieved. |
show_progress |
logical, if true, a progress bar will be shown. Default is TRUE. |
A data frame that contains information about protein-metal binding sites. The data frame contains some columns that might not be self explanatory.
auth_id_metal: Unique structure atom identifier of the metal, which is provided by the author of the structure in order to match the identification used in the publication that describes the structure.
auth_seq_id_metal: Residue identifier of the metal, which is provided by the author of the structure in order to match the identification used in the publication that describes the structure.
pattern: Metal pattern for each metal bound by the structure.
is_representative: A representative site is a site selected to represent a cluster of equivalent sites. The selection is done by choosing the PDB structure with the best X-ray resolution among those containing the sites in the cluster. NMR structures are generally discarded in favor of X-ray structures, unless all the sites in the cluster are found in NMR structures.
auth_asym_id_ligand: Chain identifier of the metal-coordinating ligand residues, which is provided by the author of the structure in order to match the identification used in the publication that describes the structure.
auth_seq_id_ligand: Residue identifier of the metal-coordinating ligand residues, which is provided by the author of the structure in order to match the identification used in the publication that describes the structure.
auth_id_ligand: Unique structure atom identifier of the metal-coordinating ligand r esidues, which is provided by the author of the structure in order to match the identification used in the publication that describes the structure.
auth_atom_id_ligand: Unique residue specific atom identifier of the metal-coordinating ligand residues, which is provided by the author of the structure in order to match the identification used in the publication that describes the structure.
head(fetch_metal_pdb(id_value = c("P42345", "P00918"))) fetch_metal_pdb(id_type = "pdb", id_value = c("1g54"), metal = "Zn")head(fetch_metal_pdb(id_value = c("P42345", "P00918"))) fetch_metal_pdb(id_type = "pdb", id_value = c("1g54"), metal = "Zn")
Fetches information about disordered and flexible protein regions from MobiDB.
fetch_mobidb( uniprot_ids = NULL, organism_id = NULL, show_progress = TRUE, timeout = 60, max_tries = 2 )fetch_mobidb( uniprot_ids = NULL, organism_id = NULL, show_progress = TRUE, timeout = 60, max_tries = 2 )
uniprot_ids |
optional, a character vector of UniProt identifiers for which information
should be fetched. This argument is mutually exclusive to the |
organism_id |
optional, a character value providing the NCBI taxonomy identifier of an organism
(TaxId) of an organism for which all available information should be retreived. This
argument is mutually exclusive to the |
show_progress |
a logical value; if |
timeout |
a numeric value specifying the time in seconds until the download of an organism archive times out. The default is 60 seconds. |
max_tries |
a numeric value that specifies the number of times the function tries to download the data in case an error occurs. The default is 2. |
A data frame that contains start and end positions for disordered and flexible protein
regions. The feature column contains information on the source of this
annotation. More information on the source can be found
here.
fetch_mobidb( uniprot_ids = c("P0A799", "P62707") )fetch_mobidb( uniprot_ids = c("P0A799", "P62707") )
Fetches structure metadata from RCSB. If you want to retrieve atom data such as positions, use
the function fetch_pdb_structure().
fetch_pdb(pdb_ids, batchsize = 100, show_progress = TRUE)fetch_pdb(pdb_ids, batchsize = 100, show_progress = TRUE)
pdb_ids |
a character vector of PDB identifiers. |
batchsize |
a numeric value that specifies the number of structures to be processed in a single query. Default is 100. |
show_progress |
a logical value that indicates if a progress bar will be shown. Default is TRUE. |
A data frame that contains structure metadata for the PDB IDs provided. The data frame contains some columns that might not be self explanatory.
auth_asym_id: Chain identifier provided by the author of the structure in order to match the identification used in the publication that describes the structure.
label_asym_id: Chain identifier following the standardised convention for mmCIF files.
entity_beg_seq_id, ref_beg_seq_id, length, pdb_sequence: entity_beg_seq_id is a
position in the structure sequence (pdb_sequence) that matches the position given in
ref_beg_seq_id, which is a position within the protein sequence (not included in the
data frame). length identifies the stretch of sequence for which positions match
accordingly between structure and protein sequence. entity_beg_seq_id is a residue ID
based on the standardised convention for mmCIF files.
auth_seq_id: Residue identifier provided by the author of the structure in order to
match the identification used in the publication that describes the structure. This character
vector has the same length as the pdb_sequence and each position is the identifier for
the matching amino acid position in pdb_sequence. The contained values are not
necessarily numbers and the values do not have to be positive.
modified_monomer: Is composed of first the composition ID of the modification, followed
by the label_seq_id position. In parenthesis are the parent monomer identifiers as
they appear in the sequence.
ligand_*: Any column starting with the ligand_* prefix contains information about
the position, identity and donors for ligand binding sites. If there are multiple entities of
ligands they are separated by "|". Specific donor level information is separated by ";".
secondar_structure: Contains information about helix and sheet secondary structure elements. Individual regions are separated by ";".
unmodeled_structure: Contains information about unmodeled or partially modeled regions in the model. Individual regions are separated by ";".
auth_seq_id_original: In some cases the sequence positions do not match the number of residues
in the sequence either because positions are missing or duplicated. This always coincides with modified
residues, however does not always occur when there is a modified residue in the sequence. This column
contains the original auth_seq_id information that does not have these positions corrected.
pdb <- fetch_pdb(pdb_ids = c("6HG1", "1E9I", "6D3Q", "4JHW")) head(pdb)pdb <- fetch_pdb(pdb_ids = c("6HG1", "1E9I", "6D3Q", "4JHW")) head(pdb)
Fetches atom data for a PDB structure from RCSB. If you want to retrieve metadata about PDB
structures, use the function fetch_pdb(). The information retrieved is based on the
.cif file of the structure, which may vary from the .pdb file.
fetch_pdb_structure(pdb_ids, return_data_frame = FALSE, show_progress = TRUE)fetch_pdb_structure(pdb_ids, return_data_frame = FALSE, show_progress = TRUE)
pdb_ids |
a character vector of PDB identifiers. |
return_data_frame |
a logical value that indicates if a data frame instead of a list is returned. It is recommended to only use this if not many pdb structures are retrieved. Default is FALSE. |
show_progress |
a logical value that indicates if a progress bar will be shown. Default is TRUE. |
A list that contains atom data for each PDB structures provided. If return_data_frame is TRUE, a data frame with this information is returned instead. The data frame contains the following columns:
label_id: Uniquely identifies every atom in the structure following the standardised convention for mmCIF files. Example value: "5", "C12", "Ca3g28", "Fe3+17", "H*251", "boron2a", "C a phe 83 a 0", "Zn Zn 301 A 0"
type_symbol: The code used to identify the atom species representing this atom type. Normally this code is the element symbol. The code may be composed of any character except an underscore with the additional proviso that digits designate an oxidation state and must be followed by a + or - character. Example values: "C", "Cu2+", "H(SDS)", "dummy", "FeNi".
label_atom_id: Uniquely identifies every atom for the given residue following the standardised convention for mmCIF files. Example values: "CA", "HB1", "CB", "N"
label_comp_id: A chemical identifier for the residue. For protein polymer entities, this is the three- letter code for the amino acid. For nucleic acid polymer entities, this is the one-letter code for the base. Example values: "ala", "val", "A", "C".
label_asym_id: Chain identifier following the standardised convention for mmCIF files. Example values: "1", "A", "2B3".
entity_id: Records details about the molecular entities that are present in the crystallographic structure. Usually all different types of molecular entities such as polymer entities, non-polymer entities or water molecules are numbered once for each structure. Each type of non-polymer entity has its own number. Thus, the highest number in this column represents the number of different molecule types in the structure.
label_seq_id: Uniquely and sequentially identifies residues for each label_asym_id.
This is always a number and the sequence of numbers always progresses in increasing numerical order.
x: The x coordinate of the atom.
y: The y coordinate of the atom.
z: The z coordinate of the atom.
site_occupancy: The fraction of the atom type present at this site.
b_iso_or_equivalent: Contains the B-factor or isotopic atomic displacement factor for each atom.
formal_charge: The net integer charge assigned to this atom. This is the formal charge assignment normally found in chemical diagrams. It is currently only assigned in a small subset of structures.
auth_seq_id: An alternative residue identifier (label_seq_id) provided by the
author of the structure in order to match the identification used in the publication that
describes the structure. This does not need to be numeric and is therefore of type character.
auth_comp_id: An alternative chemical identifier (label_comp_id) provided by the
author of the structure in order to match the identification used in the publication that
describes the structure.
auth_asym_id: An alternative chain identifier (label_asym_id) provided by the
author of the structure in order to match the identification used in the publication that
describes the structure.
pdb_model_number: The PDB model number.
pdb_id: The protein database identifier for the structure.
pdb_structure <- fetch_pdb_structure( pdb_ids = c("6HG1", "1E9I", "6D3Q", "4JHW"), return_data_frame = TRUE ) head(pdb_structure, n = 10)pdb_structure <- fetch_pdb_structure( pdb_ids = c("6HG1", "1E9I", "6D3Q", "4JHW"), return_data_frame = TRUE ) head(pdb_structure, n = 10)
Fetches gene ontology (GO) annotations, terms or slims from the QuickGO EBI database. Annotations can be retrieved for specific UniProt IDs or NCBI taxonomy identifiers. When terms are retrieved, a complete list of all GO terms is returned. For the generation of a slim dataset you can provide GO IDs that should be considered. A slim dataset is a subset GO dataset that considers all child terms of the supplied IDs.
fetch_quickgo( type = "annotations", id_annotations = NULL, taxon_id_annotations = NULL, ontology_annotations = "all", go_id_slims = NULL, relations_slims = c("is_a", "part_of", "regulates", "occurs_in"), timeout = 1200, max_tries = 2, show_progress = TRUE )fetch_quickgo( type = "annotations", id_annotations = NULL, taxon_id_annotations = NULL, ontology_annotations = "all", go_id_slims = NULL, relations_slims = c("is_a", "part_of", "regulates", "occurs_in"), timeout = 1200, max_tries = 2, show_progress = TRUE )
type |
a character value that indicates if gene ontology terms, annotations or slims should be retrieved. The possible values therefore include "annotations", "terms" and "slims". If annotations are retrieved, the maximum number of results is 2,000,000. |
id_annotations |
an optional character vector that specifies UniProt IDs for which GO annotations should be retrieved. This argument should only be provided if annotations are retrieved. |
taxon_id_annotations |
an optional character value that specifies the NCBI taxonomy identifier (TaxId) for an organism for which GO annotations should be retrieved. This argument should only be provided if annotations are retrieved. |
ontology_annotations |
an optional character value that specifies the ontology that should be retrieved. This can either have the values "all", "molecular_function", "biological_process" or "cellular_component". This argument should only be provided if annotations are retrieved. |
go_id_slims |
an optional character vector that specifies gene ontology IDs (e.g. GO:0046872) for which a slim go set should be generated. This argument should only be provided if slims are retrieved. |
relations_slims |
an optional character vector that specifies the relations of GO IDs that should be considered for the generation of the slim dataset. This argument should only be provided if slims are retrieved. |
timeout |
a numeric value specifying the time in seconds until the download times out. The default is 1200 seconds. |
max_tries |
a numeric value that specifies the number of times the function tries to download the data in case an error occurs. The default is 2. |
show_progress |
a logical value that indicates if a progress bar will be shown. Default is TRUE. |
A data frame that contains descriptive information about gene ontology annotations, terms or slims depending on what the input "type" was.
# Annotations annotations <- fetch_quickgo( type = "annotations", id = c("P63328", "Q4FFP4"), ontology = "molecular_function" ) head(annotations) # Terms terms <- fetch_quickgo(type = "terms") head(terms) # Slims slims <- fetch_quickgo( type = "slims", go_id_slims = c("GO:0046872", "GO:0051540") ) head(slims)# Annotations annotations <- fetch_quickgo( type = "annotations", id = c("P63328", "Q4FFP4"), ontology = "molecular_function" ) head(annotations) # Terms terms <- fetch_quickgo(type = "terms") head(terms) # Slims slims <- fetch_quickgo( type = "slims", go_id_slims = c("GO:0046872", "GO:0051540") ) head(slims)
Fetches protein metadata from UniProt.
fetch_uniprot( uniprot_ids, columns = c("protein_name", "length", "sequence", "gene_names", "xref_geneid", "xref_string", "go_f", "go_p", "go_c", "cc_interaction", "ft_act_site", "ft_binding", "cc_cofactor", "cc_catalytic_activity", "xref_pdb", "keyword"), batchsize = 100, max_tries = 10, timeout = 20, show_progress = TRUE )fetch_uniprot( uniprot_ids, columns = c("protein_name", "length", "sequence", "gene_names", "xref_geneid", "xref_string", "go_f", "go_p", "go_c", "cc_interaction", "ft_act_site", "ft_binding", "cc_cofactor", "cc_catalytic_activity", "xref_pdb", "keyword"), batchsize = 100, max_tries = 10, timeout = 20, show_progress = TRUE )
uniprot_ids |
a character vector of UniProt accession numbers. |
columns |
a character vector of metadata columns that should be imported from UniProt (all
possible columns can be found here. For
cross-referenced database provide the database name with the prefix "xref_", e.g. |
batchsize |
a numeric value that specifies the number of proteins processed in a single single query. Default and max value is 100. |
max_tries |
a numeric value that specifies the number of times the function tries to download the data in case an error occurs. The default is 10. |
timeout |
a numeric value that specifies the maximum request time per try. Default is 20 seconds. |
show_progress |
a logical value that determines if a progress bar will be shown. Default is TRUE. |
A data frame that contains all protein metadata specified in columns for the
proteins provided. The input_id column contains the provided UniProt IDs. If an invalid ID
was provided that contains a valid UniProt ID, the valid portion of the ID is still fetched and
present in the accession column, while the input_id column contains the original not completely
valid ID.
fetch_uniprot(c("P36578", "O43324", "Q00796")) # Not completely valid ID fetch_uniprot(c("P02545", "P02545;P20700"))fetch_uniprot(c("P36578", "O43324", "Q00796")) # Not completely valid ID fetch_uniprot(c("P02545", "P02545;P20700"))
Fetches proteome data from UniProt for the provided organism ID.
fetch_uniprot_proteome( organism_id, columns = c("accession"), reviewed = TRUE, timeout = 120, max_tries = 5 )fetch_uniprot_proteome( organism_id, columns = c("accession"), reviewed = TRUE, timeout = 120, max_tries = 5 )
organism_id |
a numeric value that specifies the NCBI taxonomy identifier (TaxId) for an organism. |
columns |
a character vector of metadata columns that should be imported from UniProt (all
possible columns can be found here. For
cross-referenced database provide the database name with the prefix "xref_", e.g. |
reviewed |
a logical value that determines if only reviewed protein entries will be retrieved. |
timeout |
a numeric value specifying the time in seconds until the download times out. The default is 60 seconds. |
max_tries |
a numeric value that specifies the number of times the function tries to download the data in case an error occurs. The default is 2. |
A data frame that contains all protein metadata specified in columns for the
organism of choice.
head(fetch_uniprot_proteome(9606))head(fetch_uniprot_proteome(9606))
Filters the input data based on precursor, peptide or protein intensity coefficients of variation. The function should be used to ensure that only robust measurements and quantifications are used for data analysis. It is advised to use the function after inspection of raw values (quality control) and median normalisation. Generally, the function calculates CVs of each peptide, precursor or protein for each condition and removes peptides, precursors or proteins that have a CV above the cutoff in less than the (user-defined) required number of conditions. Since the user-defined cutoff is fixed and does not depend on the number of conditions that have detected values, the function might bias for data completeness.
filter_cv( data, grouping, condition, log2_intensity, cv_limit = 0.25, min_conditions, silent = FALSE )filter_cv( data, grouping, condition, log2_intensity, cv_limit = 0.25, min_conditions, silent = FALSE )
data |
a data frame that contains at least the input variables. |
grouping |
a character column in the |
condition |
a character or numeric column in the |
log2_intensity |
a numeric column in the |
cv_limit |
optional, a numeric value that specifies the CV cutoff that will be applied. Default is 0.25. |
min_conditions |
a numeric value that specifies the minimum number of conditions for which grouping CVs should be below the cutoff. |
silent |
a logical value that specifies if a message with the number of filtered out conditions should be returned. Default is FALSE. |
The CV filtered data frame.
set.seed(123) # Makes example reproducible # Create synthetic data data <- create_synthetic_data( n_proteins = 50, frac_change = 0.05, n_replicates = 3, n_conditions = 2, method = "effect_random", additional_metadata = FALSE ) # Filter coefficients of variation data_filtered <- filter_cv( data = data, grouping = peptide, condition = condition, log2_intensity = peptide_intensity_missing, cv_limit = 0.25, min_conditions = 2 )set.seed(123) # Makes example reproducible # Create synthetic data data <- create_synthetic_data( n_proteins = 50, frac_change = 0.05, n_replicates = 3, n_conditions = 2, method = "effect_random", additional_metadata = FALSE ) # Filter coefficients of variation data_filtered <- filter_cv( data = data, grouping = peptide, condition = condition, log2_intensity = peptide_intensity_missing, cv_limit = 0.25, min_conditions = 2 )
For a given ID, find all sub IDs and their sub IDs etc. The type of relationship can be selected too. This is a helper function for other functions.
find_all_subs( data, ids, main_id = id, type = type, accepted_types = "is_a", exclude_parent_id = FALSE )find_all_subs( data, ids, main_id = id, type = type, accepted_types = "is_a", exclude_parent_id = FALSE )
data |
a data frame that contains relational information on IDs (main_id) their sub
IDs (sub_id) and their relationship (type). For ChEBI this data frame can be obtained by calling
|
ids |
a character vector of IDs for which sub IDs should be searched. |
main_id |
a character or integer column containing IDs. Default is |
type |
a character column that contains the type of interactions. Default is |
accepted_types |
a character vector containing the accepted_types of relationships that should be considered for the search. It is possible to use "all" relationships. The default type is "is_a". A list of possible relationships for e.g. ChEBI IDs can be found here. |
exclude_parent_id |
a logical value that specifies if the parent ID should be included in the returned list. |
A list of character vectors containing the provided ID and all of its sub IDs. It contains one element per input ID.
Search for chebi IDs that match a specific name pattern. A list of corresponding ChEBI IDs is returned.
find_chebis(chebi_data, pattern)find_chebis(chebi_data, pattern)
chebi_data |
a data frame that contains at least information on ChEBI IDs (id) and their
names (name). This data frame can be obtained by calling |
pattern |
a character vector that contains names or name patterns of molecules. Name
patterns can be for example obtained with the |
A list of character vectors containing ChEBI IDs that have a name matching the supplied pattern. It contains one element per pattern.
The position of the given peptide sequence is searched within the given protein sequence. In addition the last amino acid of the peptide and the amino acid right before are reported.
find_peptide(data, protein_sequence, peptide_sequence)find_peptide(data, protein_sequence, peptide_sequence)
data |
a data frame that contains at least the protein and peptide sequence. |
protein_sequence |
a character column in the |
peptide_sequence |
a character column in the |
A data frame that contains the input data and four additional columns with peptide start and end position, the last amino acid and the amino acid before the peptide.
# Create example data data <- data.frame( protein_sequence = c("abcdefg"), peptide_sequence = c("cde") ) # Find peptide find_peptide( data = data, protein_sequence = protein_sequence, peptide_sequence = peptide_sequence )# Create example data data <- data.frame( protein_sequence = c("abcdefg"), peptide_sequence = c("cde") ) # Find peptide find_peptide( data = data, protein_sequence = protein_sequence, peptide_sequence = peptide_sequence )
Finds peptide positions in a PDB structure. Often positions of peptides in UniProt and a PDB structure are different due to different lengths of structures. This function maps a peptide based on its UniProt positions onto a PDB structure. This method is superior to sequence alignment of the peptide to the PDB structure sequence, since it can also match the peptide if there are truncations or mismatches. This function also provides an easy way to check if a peptide is present in a PDB structure.
find_peptide_in_structure( peptide_data, peptide, start, end, uniprot_id, pdb_data = NULL, retain_columns = NULL )find_peptide_in_structure( peptide_data, peptide, start, end, uniprot_id, pdb_data = NULL, retain_columns = NULL )
peptide_data |
a data frame containing at least the input columns to this function. |
peptide |
a character column in the |
start |
a numeric column in the |
end |
a numeric column in the |
uniprot_id |
a character column in the |
pdb_data |
optional, a data frame containing data obtained with |
retain_columns |
a vector indicating if certain columns should be retained from the input
data frame. Default is not retaining additional columns |
A data frame that contains peptide positions in the corresponding PDB structures. If a peptide is not found in any structure or no structure is associated with the protein, the data frame contains NAs values for the output columns. The data frame contains the following and additional columns:
auth_asym_id: Chain identifier provided by the author of the structure in order to match the identification used in the publication that describes the structure.
label_asym_id: Chain identifier following the standardised convention for mmCIF files.
peptide_seq_in_pdb: The sequence of the peptide mapped to the structure. If the peptide only maps partially, then only the part of the sequence that maps on the structure is returned.
fit_type: The fit type is either "partial" or "fully" and it indicates if the complete peptide or only part of it was found in the structure.
start_adjusted: The adjusted start position of the peptide if the peptide was only partially covered by the structure. If the peptide is fully covered it is just the provided start position.
end_adjusted: The adjusted end position of the peptide if the peptide was only partially covered by the structure. If the peptide is fully covered it is just the provided end position.
label_seq_id_start: Contains the first residue position of the peptide in the structure following the standardised convention for mmCIF files.
label_seq_id_end: Contains the last residue position of the peptide in the structure following the standardised convention for mmCIF files.
auth_seq_id_start: Contains the first residue position of the peptide in the structure based on the alternative residue identifier provided by the author of the structure in order to match the identification used in the publication that describes the structure. This does not need to be numeric and is therefore of type character.
auth_seq_id_end: Contains the last residue position of the peptide in the structure based on the alternative residue identifier provided by the author of the structure in order to match the identification used in the publication that describes the structure. This does not need to be numeric and is therefore of type character.
auth_seq_id: Contains all positions (separated by ";") of the peptide in the structure based on the alternative residue identifier provided by the author of the structure in order to match the identification used in the publication that describes the structure. This does not need to be numeric and is therefore of type character.
n_peptides: The number of peptides from one protein that were searched for within the current structure.
n_peptides_in_structure: The number of peptides from one protein that were found within the current structure.
percentage_covered_peptides: The percentage of all provided peptides that were at least partially found in the structure.
# Create example data peptide_data <- data.frame( uniprot_id = c("P0A8T7", "P0A8T7", "P60906"), peptide_sequence = c( "SGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNV", "NVFEGERVER", "AIGEVTDVVEKE" ), start = c(1160, 1197, 55), end = c(1198, 1206, 66) ) # Find peptides in protein structure peptide_in_structure <- find_peptide_in_structure( peptide_data = peptide_data, peptide = peptide_sequence, start = start, end = end, uniprot_id = uniprot_id ) head(peptide_in_structure, n = 10)# Create example data peptide_data <- data.frame( uniprot_id = c("P0A8T7", "P0A8T7", "P60906"), peptide_sequence = c( "SGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNV", "NVFEGERVER", "AIGEVTDVVEKE" ), start = c(1160, 1197, 55), end = c(1198, 1206, 66) ) # Find peptides in protein structure peptide_in_structure <- find_peptide_in_structure( peptide_data = peptide_data, peptide = peptide_sequence, start = start, end = end, uniprot_id = uniprot_id ) head(peptide_in_structure, n = 10)
Function for fitting four-parameter dose response curves for each group (precursor, peptide or protein). In addition it can annotate data based on completeness, the completeness distribution and statistical testing using ANOVA. Filtering by the function is only performed based on completeness if selected.
fit_drc_4p( data, sample, grouping, response, dose, filter = "post", replicate_completeness = 0.7, condition_completeness = 0.5, n_replicate_completeness = NULL, n_condition_completeness = NULL, complete_doses = NULL, anova_cutoff = 0.05, correlation_cutoff = 0.8, log_logarithmic = TRUE, include_models = FALSE, retain_columns = NULL )fit_drc_4p( data, sample, grouping, response, dose, filter = "post", replicate_completeness = 0.7, condition_completeness = 0.5, n_replicate_completeness = NULL, n_condition_completeness = NULL, complete_doses = NULL, anova_cutoff = 0.05, correlation_cutoff = 0.8, log_logarithmic = TRUE, include_models = FALSE, retain_columns = NULL )
If data filtering options are selected, data is annotated based on multiple criteria.
If "post" is selected the data is annotated based on completeness, the completeness distribution, the
adjusted ANOVA p-value cutoff and a correlation cutoff. Completeness of features is determined based on
the n_replicate_completeness and n_condition_completeness arguments. The completeness distribution determines
if there is a distribution of not random missingness of data along the dose. For this it is checked if half of a
features values (+/-1 value) pass the replicate completeness criteria and half do not pass it. In order to fall into
this category, the values that fulfill the completeness cutoff and the ones that do not fulfill it
need to be consecutive, meaning located next to each other based on their concentration values. Furthermore,
the values that do not pass the completeness cutoff need to be lower in intensity. Lastly, the difference
between the two groups is tested for statistical significance using a Welch's t-test and a
cutoff of p <= 0.1 (we want to mainly discard curves that falsely fit the other criteria but that
have clearly non-significant differences in mean). This allows curves to be considered that have
missing values in half of their observations due to a decrease in intensity. It can be thought
of as conditions that are missing not at random (MNAR). It is often the case that those entities
do not have a significant p-value since half of their conditions are not considered due to data
missingness. The ANOVA test is performed on the features by concentration. If it is significant it is
likely that there is some response. However, this test would also be significant even if there is one
outlier concentration so it should only be used only in combination with other cutoffs to determine
if a feature is significant. The passed_filter column is TRUE for all the
features that pass the above mentioned criteria and that have a correlation greater than the cutoff
(default is 0.8) and the adjusted ANOVA p-value below the cutoff (default is 0.05).
The final list is ranked based on a score calculated on entities that pass the filter.
The score is the negative log10 of the adjusted ANOVA p-value scaled between 0 and 1 and the
correlation scaled between 0 and 1 summed up and divided by 2. Thus, the highest score an
entity can have is 1 with both the highest correlation and adjusted p-value. The rank is
corresponding to this score. Please note, that entities with MNAR conditions might have a
lower score due to the missing or non-significant ANOVA p-value. If no score could be calculated
the usual way these cases receive a score of 0. You should have a look at curves that are TRUE
for dose_MNAR in more detail.
If the "pre" option is selected for the filter argument then the data is filtered for completeness
prior to curve fitting and the ANOVA test. Otherwise annotation is performed exactly as mentioned above.
We recommend the "pre" option because it leaves you with not only the likely hits of your treatment, but
also with rather high confidence true negative results. This is because the filtered data has a high
degree of completeness making it unlikely that a real dose-response curve is missed due to data missingness.
Please note that in general, curves are only fitted if there are at least 5 conditions with data points present to ensure that there is potential for a good curve fit. This is done independent of the selected filtering option.
If include_models = FALSE a data frame is returned that contains correlations
of predicted to measured values as a measure of the goodness of the curve fit, an associated
p-value and the four parameters of the model for each group. Furthermore, input data for plots
is returned in the columns plot_curve (curve and confidence interval) and plot_points
(measured points). If include_models = TURE, a list is returned that contains:
fit_objects: The fit objects of type drc for each group.
correlations: The correlation data frame described above
# Load libraries library(dplyr) set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 2, frac_change = 1, n_replicates = 3, n_conditions = 8, method = "dose_response", concentrations = c(0, 1, 10, 50, 100, 500, 1000, 5000), additional_metadata = FALSE ) # Perform dose response curve fit drc_fit <- fit_drc_4p( data = data, sample = sample, grouping = peptide, response = peptide_intensity_missing, dose = concentration, n_replicate_completeness = 2, n_condition_completeness = 5, retain_columns = c(protein, change_peptide) ) glimpse(drc_fit) head(drc_fit, n = 10)# Load libraries library(dplyr) set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 2, frac_change = 1, n_replicates = 3, n_conditions = 8, method = "dose_response", concentrations = c(0, 1, 10, 50, 100, 500, 1000, 5000), additional_metadata = FALSE ) # Perform dose response curve fit drc_fit <- fit_drc_4p( data = data, sample = sample, grouping = peptide, response = peptide_intensity_missing, dose = concentration, n_replicate_completeness = 2, n_condition_completeness = 5, retain_columns = c(protein, change_peptide) ) glimpse(drc_fit) head(drc_fit, n = 10)
impute is calculating imputation values for missing data depending on the selected
method.
impute( data, sample, grouping, intensity_log2, condition, comparison = comparison, missingness = missingness, noise = NULL, method = "ludovic", skip_log2_transform_error = FALSE, retain_columns = NULL )impute( data, sample, grouping, intensity_log2, condition, comparison = comparison, missingness = missingness, noise = NULL, method = "ludovic", skip_log2_transform_error = FALSE, retain_columns = NULL )
data |
a data frame that is ideally the output from the |
sample |
a character column in the |
grouping |
a character column in the |
intensity_log2 |
a numeric column in the |
condition |
a character or numeric column in the |
comparison |
a character column in the |
missingness |
a character column in the |
noise |
a numeric column in the |
method |
a character value that specifies the method to be used for imputation. For
|
skip_log2_transform_error |
a logical value that determines if a check is performed to validate that input values are log2 transformed. If input values are > 40 the test is failed and an error is returned. |
retain_columns |
a vector that indicates columns that should be retained from the input
data frame. Default is not retaining additional columns |
A data frame that contains an imputed_intensity and imputed column in
addition to the required input columns. The imputed column indicates if a value was
imputed. The imputed_intensity column contains imputed intensity values for previously
missing intensities.
set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 10, frac_change = 0.5, n_replicates = 4, n_conditions = 2, method = "effect_random", additional_metadata = FALSE ) head(data, n = 24) # Assign missingness information data_missing <- assign_missingness( data, sample = sample, condition = condition, grouping = peptide, intensity = peptide_intensity_missing, ref_condition = "all", retain_columns = c(protein, peptide_intensity) ) head(data_missing, n = 24) # Perform imputation data_imputed <- impute( data_missing, sample = sample, grouping = peptide, intensity_log2 = peptide_intensity_missing, condition = condition, comparison = comparison, missingness = missingness, method = "ludovic", retain_columns = c(protein, peptide_intensity) ) head(data_imputed, n = 24)set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 10, frac_change = 0.5, n_replicates = 4, n_conditions = 2, method = "effect_random", additional_metadata = FALSE ) head(data, n = 24) # Assign missingness information data_missing <- assign_missingness( data, sample = sample, condition = condition, grouping = peptide, intensity = peptide_intensity_missing, ref_condition = "all", retain_columns = c(protein, peptide_intensity) ) head(data_missing, n = 24) # Perform imputation data_imputed <- impute( data_missing, sample = sample, grouping = peptide, intensity_log2 = peptide_intensity_missing, condition = condition, comparison = comparison, missingness = missingness, method = "ludovic", retain_columns = c(protein, peptide_intensity) ) head(data_imputed, n = 24)
impute_randomforest performs imputation for missing values in the data using the random
forest-based method implemented in the missForest package.
impute_randomforest( data, sample, grouping, intensity_log2, retain_columns = NULL, ... )impute_randomforest( data, sample, grouping, intensity_log2, retain_columns = NULL, ... )
data |
A data frame that contains the input variables. This should include columns for the sample names, precursor or peptide identifiers, and intensity values. |
sample |
A character column in the |
grouping |
A character column in the |
intensity_log2 |
A numeric column in the |
retain_columns |
A character vector indicating which columns should be retained from the
input data frame. These columns will be preserved in the output alongside the imputed values.
By default, no additional columns are retained ( |
... |
Additional parameters to pass to the |
The function imputes missing values by building random forests, where missing values are predicted based on other available values within the dataset. For each variable with missing data, the function trains a random forest model using the available (non-missing) data in that variable, and subsequently predicts the missing values.
In addition to the imputed values, users can choose to retain additional columns from the original input data frame that were not part of the imputation process.
This function allows passing additional parameters to the underlying missForest function,
such as controlling the number of trees used in the random forest models or specifying the
stopping criteria. For a full list of parameters, refer to the missForest documentation.
To enable parallelisation, ensure that the doParallel package is installed and loaded:
install.packages("doParallel")
library(doParallel)
Then register the desired number of cores for parallel processing:
registerDoParallel(cores = 6)
To leverage parallelisation during the imputation, pass parallelize = "variables"
as an argument to the missForest function.
A data frame that contains an imputed_intensity column with the imputed values
and an imputed column indicating whether each value was imputed (TRUE) or not
(FALSE), in addition to any columns retained via retain_columns.
Elena Krismer
Stekhoven, D.J., & Bühlmann, P. (2012). MissForest—non-parametric missing value imputation for mixed-type data. Bioinformatics, 28(1), 112-118. https://doi.org/10.1093/bioinformatics/btr597
set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 10, frac_change = 0.5, n_replicates = 4, n_conditions = 2, method = "effect_random", additional_metadata = FALSE ) head(data, n = 24) # Perform imputation data_imputed <- impute_randomforest( data, sample = sample, grouping = peptide, intensity_log2 = peptide_intensity_missing ) head(data_imputed, n = 24)set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 10, frac_change = 0.5, n_replicates = 4, n_conditions = 2, method = "effect_random", additional_metadata = FALSE ) head(data, n = 24) # Perform imputation data_imputed <- impute_randomforest( data, sample = sample, grouping = peptide, intensity_log2 = peptide_intensity_missing ) head(data_imputed, n = 24)
A perceptually uniform colour scheme originally created for the Seaborn python package.
mako_coloursmako_colours
A vector containing 256 colours
created for the Seaborn statistical data visualization package for Python
Peptides are mapped onto PDB structures or AlphaFold prediction based on their positions. This is accomplished by replacing the B-factor information in the structure file with values that allow highlighting of peptides, protein regions or amino acids when the structure is coloured by B-factor. In addition to simply highlighting peptides, protein regions or amino acids, a continuous variable such as fold changes associated with them can be mapped onto the structure as a colour gradient.
map_peptides_on_structure( peptide_data, uniprot_id, pdb_id, chain, auth_seq_id, map_value, baseline_map_value = NULL, file_format = ".cif", alphafold_version = "v6", scale_per_structure = TRUE, export_location = NULL, structure_file = NULL, show_progress = TRUE )map_peptides_on_structure( peptide_data, uniprot_id, pdb_id, chain, auth_seq_id, map_value, baseline_map_value = NULL, file_format = ".cif", alphafold_version = "v6", scale_per_structure = TRUE, export_location = NULL, structure_file = NULL, show_progress = TRUE )
peptide_data |
a data frame that contains the input columns to this function. If structure
or prediction files should be fetched automatically, please provide column names to the following
arguments: uniprot_id, pdb_id, chain, auth_seq_id,
map_value. If no PDB structure for a protein is available the |
uniprot_id |
a character column in the |
pdb_id |
a character column in the |
chain |
a character column in the |
auth_seq_id |
a character (or numeric) column in the |
map_value |
a numeric column in the |
baseline_map_value |
optional, a numeric value defining the baseline of the
|
file_format |
a character vector containing the file format of the structure that will be
fetched from the database for the PDB identifiers provided in the |
alphafold_version |
a character value that specifies the alphafold version that should be used. This is regularly updated by the database. We always try to make the current version the default version. Available version can be found here: https://ftp.ebi.ac.uk/pub/databases/alphafold/ |
scale_per_structure |
a logical value that specifies if scaling should be performed for each structure independently (TRUE) or over the whole data set (FALSE). The default is TRUE, which scales the scores of each structure independently so that each structure has a score range from 50 to 100. |
export_location |
optional, a character argument specifying the path to the location in which the fetched and altered structure files should be saved. If left empty, they will be saved in the current working directory. The location should be provided in the following format "folderA/folderB". |
structure_file |
optional, a character argument specifying the path to the location and
name of a structure file in ".cif" or ".pdb" format. If a structure is provided the |
show_progress |
a logical, if |
The function exports a modified ".pdb" or ".cif" structure file. B-factors have been
replaced with scaled (50-100) values provided in the map_value column.
# Load libraries library(dplyr) # Create example data peptide_data <- data.frame( uniprot_id = c("P0A8T7", "P0A8T7", "P60906"), peptide_sequence = c( "SGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNV", "NVFEGERVER", "AIGEVTDVVEKE" ), start = c(1160, 1197, 55), end = c(1198, 1206, 66), map_value = c(70, 100, 100) ) # Find peptide positions in structures positions_structure <- find_peptide_in_structure( peptide_data = peptide_data, peptide = peptide_sequence, start = start, end = end, uniprot_id = uniprot_id, retain_columns = c(map_value)) %>% filter(pdb_ids %in% c("6UU2", "2EL9")) # Map peptides on structures # You can determine the preferred output location # with the export_location argument. Currently it # is saved in the working directory. map_peptides_on_structure( peptide_data = positions_structure, uniprot_id = uniprot_id, pdb_id = pdb_ids, chain = auth_asym_id, auth_seq_id = auth_seq_id, map_value = map_value, file_format = ".pdb", export_location = getwd() )# Load libraries library(dplyr) # Create example data peptide_data <- data.frame( uniprot_id = c("P0A8T7", "P0A8T7", "P60906"), peptide_sequence = c( "SGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNV", "NVFEGERVER", "AIGEVTDVVEKE" ), start = c(1160, 1197, 55), end = c(1198, 1206, 66), map_value = c(70, 100, 100) ) # Find peptide positions in structures positions_structure <- find_peptide_in_structure( peptide_data = peptide_data, peptide = peptide_sequence, start = start, end = end, uniprot_id = uniprot_id, retain_columns = c(map_value)) %>% filter(pdb_ids %in% c("6UU2", "2EL9")) # Map peptides on structures # You can determine the preferred output location # with the export_location argument. Currently it # is saved in the working directory. map_peptides_on_structure( peptide_data = positions_structure, uniprot_id = uniprot_id, pdb_id = pdb_ids, chain = auth_asym_id, auth_seq_id = auth_seq_id, map_value = map_value, file_format = ".pdb", export_location = getwd() )
A list that contains all ChEBI IDs that appear in UniProt and that contain either a metal atom in their formula or that do not have a formula but the ChEBI term is related to metals. This was last updated on the 08/08/24.
metal_chebi_uniprotmetal_chebi_uniprot
A data.frame containing information retrieved from ChEBI using fetch_chebi(stars = c(2, 3)),
filtered using symbols in the metal_list and manual annotation of metal related ChEBI IDs that do not
contain a formula.
UniProt (cc_cofactor, cc_catalytic_activity, ft_binding) and ChEBI
A subset of molecular function gene ontology terms related to metals that was created using the slimming process provided by the QuickGO EBI database. This was last updated on the 19/02/24.
metal_go_slim_subsetmetal_go_slim_subset
A data.frame containing a slim subset of molecular function gene ontology terms
that are related to metal binding. The slims_from_id column contains all IDs relevant
in this subset while the slims_to_ids column contains the starting IDs. If ChEBI IDs
have been annotated manually this is indicated in the database column.
QuickGO and ChEBI
A list of all metals and metalloids in the periodic table.
metal_listmetal_list
A data.frame containing the columns atomic_number, symbol, name,
type, chebi_id, chebi_ion_id.
https://en.wikipedia.org/wiki/Metal and https://en.wikipedia.org/wiki/Metalloid
Performs normalisation on intensities. For median normalisation the normalised intensity is the original intensity minus the run median plus the global median. This is also the way it is implemented in the Spectronaut search engine.
normalise(data, sample, intensity_log2, method = "median")normalise(data, sample, intensity_log2, method = "median")
data |
a data frame containing at least sample names and intensity values. Please note that if the data frame is grouped, the normalisation will be computed by group. |
sample |
a character column in the |
intensity_log2 |
a numeric column in the |
method |
a character value specifying the method to be used for normalisation. Default is "median". |
A data frame with a column called normalised_intensity_log2 containing the
normalised intensity values.
data <- data.frame( r_file_name = c("s1", "s2", "s3", "s1", "s2", "s3"), intensity_log2 = c(18, 19, 17, 20, 21, 19) ) normalise(data, sample = r_file_name, intensity_log2 = intensity_log2, method = "median" )data <- data.frame( r_file_name = c("s1", "s2", "s3", "s1", "s2", "s3"), intensity_log2 = c(18, 19, 17, 20, 21, 19) ) normalise(data, sample = r_file_name, intensity_log2 = intensity_log2, method = "median" )
This function is a wrapper around create_structure_contact_map() that allows the use of all
system cores for the creation of contact maps. Alternatively, it can be used for sequential
processing of large datasets. The benefit of this function over create_structure_contact_map()
is that it processes contact maps in batches, which is recommended for large datasets. If used
for parallel processing it should only be used on systems that have enough memory available.
Workers can either be set up manually before running the function with
future::plan(multisession) or automatically by the function (maximum number of workers
is 12 in this case). If workers are set up manually the processing_type argument should
be set to "parallel manual". In this case workers can be terminated after completion with
future::plan(sequential).
parallel_create_structure_contact_map( data, data2 = NULL, id, chain = NULL, auth_seq_id = NULL, distance_cutoff = 10, pdb_model_number_selection = c(0, 1), return_min_residue_distance = TRUE, export = FALSE, export_location = NULL, split_n = 40, processing_type = "parallel" )parallel_create_structure_contact_map( data, data2 = NULL, id, chain = NULL, auth_seq_id = NULL, distance_cutoff = 10, pdb_model_number_selection = c(0, 1), return_min_residue_distance = TRUE, export = FALSE, export_location = NULL, split_n = 40, processing_type = "parallel" )
data |
a data frame containing at least a column with PDB ID information of which the name
can be provided to the |
data2 |
optional, a data frame that contains a subset of regions for which distances to regions
provided in the |
id |
a character column in the |
chain |
optional, a character column in the |
auth_seq_id |
optional, a character (or numeric) column in the |
distance_cutoff |
a numeric value specifying the distance cutoff in Angstrom. All values for pairwise comparisons are calculated but only values smaller than this cutoff will be returned in the output. If a cutoff of e.g. 5 is selected then only residues with a distance of 5 Angstrom and less are returned. Using a small value can reduce the size of the contact map drastically and is therefore recommended. The default value is 10. |
pdb_model_number_selection |
a numeric vector specifying which models from the structure files should be considered for contact maps. E.g. NMR models often have many models in one file. The default for this argument is c(0, 1). This means the first model of each structure file is selected for contact map calculations. For AlphaFold predictions the model number is 0 (only .pdb files), therefore this case is also included here. |
return_min_residue_distance |
a logical value that specifies if the contact map should be returned for all atom distances or the minimum residue distances. Minimum residue distances are smaller in size. If atom distances are not strictly needed it is recommended to set this argument to TRUE. The default is TRUE. |
export |
a logical value that indicates if contact maps should be exported as ".csv". The
name of the file will be the structure ID. Default is |
export_location |
optional, a character value that specifies the path to the location in
which the contact map should be saved if |
split_n |
a numeric value that specifies the number of structures that should be included in each batch. Default is 40. |
processing_type |
a character value that is either "parallel" for parallel processing or
"sequential" for sequential processing. Alternatively it can also be "parallel manual" in this
case you have to set up the number of cores on your own using the |
A list of contact maps for each PDB or UniProt ID provided in the input is returned.
If the export argument is TRUE, each contact map will be saved as a ".csv" file in the
current working directory or the location provided to the export_location argument.
## Not run: # Create example data data <- data.frame( pdb_id = c("6NPF", "1C14", "3NIR"), chain = c("A", "A", NA), auth_seq_id = c("1;2;3;4;5;6;7", NA, NA) ) # Create contact map contact_maps <- parallel_create_structure_contact_map( data = data, id = pdb_id, chain = chain, auth_seq_id = auth_seq_id, split_n = 1, ) str(contact_maps[["3NIR"]]) contact_maps ## End(Not run)## Not run: # Create example data data <- data.frame( pdb_id = c("6NPF", "1C14", "3NIR"), chain = c("A", "A", NA), auth_seq_id = c("1;2;3;4;5;6;7", NA, NA) ) # Create contact map contact_maps <- parallel_create_structure_contact_map( data = data, id = pdb_id, chain = chain, auth_seq_id = auth_seq_id, split_n = 1, ) str(contact_maps[["3NIR"]]) contact_maps ## End(Not run)
This function is a wrapper around fit_drc_4p that allows the use of all system cores for
model fitting. It should only be used on systems that have enough memory available. Workers can
either be set up manually before running the function with future::plan(multisession) or
automatically by the function (maximum number of workers is 12 in this case). If workers are set
up manually the number of cores should be provided to n_cores. Worker can be terminated
after completion with future::plan(sequential). It is not possible to export the
individual fit objects when using this function as compared to the non parallel function as
they are too large for efficient export from the workers.
parallel_fit_drc_4p( data, sample, grouping, response, dose, filter = "post", replicate_completeness = 0.7, condition_completeness = 0.5, n_replicate_completeness = NULL, n_condition_completeness = NULL, complete_doses = NULL, anova_cutoff = 0.05, correlation_cutoff = 0.8, log_logarithmic = TRUE, retain_columns = NULL, n_cores = NULL )parallel_fit_drc_4p( data, sample, grouping, response, dose, filter = "post", replicate_completeness = 0.7, condition_completeness = 0.5, n_replicate_completeness = NULL, n_condition_completeness = NULL, complete_doses = NULL, anova_cutoff = 0.05, correlation_cutoff = 0.8, log_logarithmic = TRUE, retain_columns = NULL, n_cores = NULL )
If data filtering options are selected, data is annotated based on multiple criteria.
If "post" is selected the data is annotated based on completeness, the completeness distribution, the
adjusted ANOVA p-value cutoff and a correlation cutoff. Completeness of features is determined based on
the n_replicate_completeness and n_condition_completeness arguments. The completeness distribution determines
if there is a distribution of not random missingness of data along the dose. For this it is checked if half of a
features values (+/-1 value) pass the replicate completeness criteria and half do not pass it. In order to fall into
this category, the values that fulfill the completeness cutoff and the ones that do not fulfill it
need to be consecutive, meaning located next to each other based on their concentration values. Furthermore,
the values that do not pass the completeness cutoff need to be lower in intensity. Lastly, the difference
between the two groups is tested for statistical significance using a Welch's t-test and a
cutoff of p <= 0.1 (we want to mainly discard curves that falsely fit the other criteria but that
have clearly non-significant differences in mean). This allows curves to be considered that have
missing values in half of their observations due to a decrease in intensity. It can be thought
of as conditions that are missing not at random (MNAR). It is often the case that those entities
do not have a significant p-value since half of their conditions are not considered due to data
missingness. The ANOVA test is performed on the features by concentration. If it is significant it is
likely that there is some response. However, this test would also be significant even if there is one
outlier concentration so it should only be used only in combination with other cutoffs to determine
if a feature is significant. The passed_filter column is TRUE for all the
features that pass the above mentioned criteria and that have a correlation greater than the cutoff
(default is 0.8) and the adjusted ANOVA p-value below the cutoff (default is 0.05).
The final list is ranked based on a score calculated on entities that pass the filter.
The score is the negative log10 of the adjusted ANOVA p-value scaled between 0 and 1 and the
correlation scaled between 0 and 1 summed up and divided by 2. Thus, the highest score an
entity can have is 1 with both the highest correlation and adjusted p-value. The rank is
corresponding to this score. Please note, that entities with MNAR conditions might have a
lower score due to the missing or non-significant ANOVA p-value. If no score could be calculated
the usual way these cases receive a score of 0. You should have a look at curves that are TRUE
for dose_MNAR in more detail.
If the "pre" option is selected for the filter argument then the data is filtered for completeness
prior to curve fitting and the ANOVA test. Otherwise annotation is performed exactly as mentioned above.
We recommend the "pre" option because it leaves you with not only the likely hits of your treatment, but
also with rather high confidence true negative results. This is because the filtered data has a high
degree of completeness making it unlikely that a real dose-response curve is missed due to data missingness.
Please note that in general, curves are only fitted if there are at least 5 conditions with data points present to ensure that there is potential for a good curve fit. This is done independent of the selected filtering option.
A data frame is returned that contains correlations of predicted to measured values as
a measure of the goodness of the curve fit, an associated p-value and the four parameters of
the model for each group. Furthermore, input data for plots is returned in the columns plot_curve
(curve and confidence interval) and plot_points (measured points).
## Not run: # Load libraries library(dplyr) set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 2, frac_change = 1, n_replicates = 3, n_conditions = 8, method = "dose_response", concentrations = c(0, 1, 10, 50, 100, 500, 1000, 5000), additional_metadata = FALSE ) # Perform dose response curve fit drc_fit <- parallel_fit_drc_4p( data = data, sample = sample, grouping = peptide, response = peptide_intensity_missing, dose = concentration, n_replicate_completeness = 2, n_condition_completeness = 5, retain_columns = c(protein, change_peptide) ) glimpse(drc_fit) head(drc_fit, n = 10) ## End(Not run)## Not run: # Load libraries library(dplyr) set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 2, frac_change = 1, n_replicates = 3, n_conditions = 8, method = "dose_response", concentrations = c(0, 1, 10, 50, 100, 500, 1000, 5000), additional_metadata = FALSE ) # Perform dose response curve fit drc_fit <- parallel_fit_drc_4p( data = data, sample = sample, grouping = peptide, response = peptide_intensity_missing, dose = concentration, n_replicate_completeness = 2, n_condition_completeness = 5, retain_columns = c(protein, change_peptide) ) glimpse(drc_fit) head(drc_fit, n = 10) ## End(Not run)
Creates a plot of peptide abundances across samples. This is helpful to investigate effects of peptide and protein abundance changes in different samples and conditions.
peptide_profile_plot( data, sample, peptide, intensity_log2, grouping, targets, complete_sample = FALSE, protein_abundance_plot = FALSE, interactive = FALSE, export = FALSE, export_name = "peptide_profile_plots" )peptide_profile_plot( data, sample, peptide, intensity_log2, grouping, targets, complete_sample = FALSE, protein_abundance_plot = FALSE, interactive = FALSE, export = FALSE, export_name = "peptide_profile_plots" )
data |
a data frame that contains at least the input variables. |
sample |
a character column in the |
peptide |
a character column in the |
intensity_log2 |
a numeric column in the |
grouping |
a character column in the |
targets |
a character vector that specifies elements of the grouping column which should
be plotted. This can also be |
complete_sample |
a logical value that indicates if samples that are completely missing for
a given protein should be shown on the x-axis of the plot anyway. The default value is |
protein_abundance_plot |
a logical value. If the input for this plot comes directly from
|
interactive |
a logical value that indicates whether the plot should be interactive (default is FALSE). If this is TRUE only one target can be supplied to the function. Interactive plots cannot be exported either. |
export |
a logical value that indicates if plots should be exported as PDF. The output
directory will be the current working directory. The name of the file can be chosen using the
|
export_name |
a character vector that provides the name of the exported file if
|
A list of peptide profile plots.
# Create example data data <- data.frame( sample = c( rep("S1", 6), rep("S2", 6), rep("S1", 2), rep("S2", 2) ), protein_id = c( rep("P1", 12), rep("P2", 4) ), precursor = c( rep(c("A1", "A2", "B1", "B2", "C1", "D1"), 2), rep(c("E1", "F1"), 2) ), peptide = c( rep(c("A", "A", "B", "B", "C", "D"), 2), rep(c("E", "F"), 2) ), intensity = c( rnorm(n = 6, mean = 15, sd = 2), rnorm(n = 6, mean = 21, sd = 1), rnorm(n = 2, mean = 15, sd = 1), rnorm(n = 2, mean = 15, sd = 2) ) ) # Calculate protein abundances and retain precursor # abundances that can be used in a peptide profile plot complete_abundances <- calculate_protein_abundance( data, sample = sample, protein_id = protein_id, precursor = precursor, peptide = peptide, intensity_log2 = intensity, method = "sum", for_plot = TRUE ) # Plot protein abundance profile # protein_abundance_plot can be set to # FALSE to to also colour precursors peptide_profile_plot( data = complete_abundances, sample = sample, peptide = precursor, intensity_log2 = intensity, grouping = protein_id, targets = c("P1"), protein_abundance_plot = TRUE )# Create example data data <- data.frame( sample = c( rep("S1", 6), rep("S2", 6), rep("S1", 2), rep("S2", 2) ), protein_id = c( rep("P1", 12), rep("P2", 4) ), precursor = c( rep(c("A1", "A2", "B1", "B2", "C1", "D1"), 2), rep(c("E1", "F1"), 2) ), peptide = c( rep(c("A", "A", "B", "B", "C", "D"), 2), rep(c("E", "F"), 2) ), intensity = c( rnorm(n = 6, mean = 15, sd = 2), rnorm(n = 6, mean = 21, sd = 1), rnorm(n = 2, mean = 15, sd = 1), rnorm(n = 2, mean = 15, sd = 2) ) ) # Calculate protein abundances and retain precursor # abundances that can be used in a peptide profile plot complete_abundances <- calculate_protein_abundance( data, sample = sample, protein_id = protein_id, precursor = precursor, peptide = peptide, intensity_log2 = intensity, method = "sum", for_plot = TRUE ) # Plot protein abundance profile # protein_abundance_plot can be set to # FALSE to to also colour precursors peptide_profile_plot( data = complete_abundances, sample = sample, peptide = precursor, intensity_log2 = intensity, grouping = protein_id, targets = c("P1"), protein_abundance_plot = TRUE )
Uses the predicted aligned error (PAE) of AlphaFold predictions to find possible protein domains. A graph-based community clustering algorithm (Leiden clustering) is used on the predicted error (distance) between residues of a protein in order to infer pseudo-rigid groups in the protein. This is for example useful in order to know which parts of protein predictions are likely in a fixed relative position towards each other and which might have varying distances. This function is based on python code written by Tristan Croll. The original code can be found on his GitHub page.
predict_alphafold_domain( pae_list, pae_power = 1, pae_cutoff = 5, graph_resolution = 1, return_data_frame = FALSE, show_progress = TRUE )predict_alphafold_domain( pae_list, pae_power = 1, pae_cutoff = 5, graph_resolution = 1, return_data_frame = FALSE, show_progress = TRUE )
pae_list |
a list of proteins that contains aligned errors for their AlphaFold predictions.
This list can be retrieved with the |
pae_power |
a numeric value, each edge in the graph will be weighted proportional to ( |
pae_cutoff |
a numeric value, graph edges will only be created for residue pairs with |
graph_resolution |
a numeric value that regulates how aggressive the clustering algorithm is. Smaller values
lead to larger clusters. Value should be larger than zero, and values larger than 5 are unlikely to be useful.
Higher values lead to stricter (i.e. smaller) clusters. The value is provided to the Leiden clustering algorithm
of the |
return_data_frame |
a logical value; if |
show_progress |
a logical value that specifies if a progress bar will be shown. Default
is |
A list of the provided proteins that contains domain assignments for each residue. If return_data_frame is
TRUE, a data frame with this information is returned instead. The data frame contains the
following columns:
residue: The protein residue number.
domain: A numeric value representing a distinct predicted domain in the protein.
accession: The UniProt protein identifier.
# Fetch aligned errors aligned_error <- fetch_alphafold_aligned_error( uniprot_ids = c("F4HVG8", "O15552"), error_cutoff = 4 ) # Predict protein domains af_domains <- predict_alphafold_domain( pae_list = aligned_error, return_data_frame = TRUE ) head(af_domains, n = 10)# Fetch aligned errors aligned_error <- fetch_alphafold_aligned_error( uniprot_ids = c("F4HVG8", "O15552"), error_cutoff = 4 ) # Predict protein domains af_domains <- predict_alphafold_domain( pae_list = aligned_error, return_data_frame = TRUE ) head(af_domains, n = 10)
A colour scheme for protti that contains 100 colours.
protti_coloursprotti_colours
A vector containing 100 colours
Dina's imagination.
Example data used for the vignette about structural analysis. The data was obtained from Cappelletti et al. 2021 (doi:10.1016/j.cell.2020.12.021) and corresponds to two separate experiments. Both experiments were limited proteolyis coupled to mass spectrometry (LiP-MS) experiments conducted on purified proteins. The first protein is phosphoglycerate kinase 1 (pgk) and it was treated with 25mM 3-phosphoglyceric acid (3PG). The second protein is phosphoenolpyruvate-protein phosphotransferase (ptsI) and it was treated with 25mM fructose 1,6-bisphosphatase (FBP). From both experiments only peptides belonging to either protein were used for this data set. The ptsI data set contains precursor level data while the pgk data set contains peptide level data. The pgk data can be obtained from supplementary table 3 from the tab named "pgk+3PG". The ptsI data is only included as raw data and was analysed using the functions of this package.
ptsi_pgkptsi_pgk
A data frame containing differential abundances and adjusted p-values for peptides/precursors of two proteins.
Cappelletti V, Hauser T, Piazza I, Pepelnjak M, Malinovska L, Fuhrer T, Li Y, Dörig C, Boersema P, Gillet L, Grossbach J, Dugourd A, Saez-Rodriguez J, Beyer A, Zamboni N, Caflisch A, de Souza N, Picotti P. Dynamic 3D proteomes reveal protein functional alterations at high resolution in situ. Cell. 2021 Jan 21;184(2):545-559.e22. doi:10.1016/j.cell.2020.12.021. Epub 2020 Dec 23. PMID: 33357446; PMCID: PMC7836100.
Plots the distribution of p-values derived from any statistical test as a histogram.
pval_distribution_plot(data, grouping, pval, facet_by = NULL)pval_distribution_plot(data, grouping, pval, facet_by = NULL)
data |
a data frame that contains at least grouping identifiers (precursor, peptide or protein) and p-values derived from any statistical test. |
grouping |
a character column in the |
pval |
a numeric column in the |
facet_by |
optional, a character column that contains information by which the data should be faceted into multiple plots. |
A histogram plot that shows the p-value distribution.
set.seed(123) # Makes example reproducible # Create example data data <- data.frame( peptide = paste0("peptide", 1:1000), pval = runif(n = 1000) ) # Plot p-values pval_distribution_plot( data = data, grouping = peptide, pval = pval )set.seed(123) # Makes example reproducible # Create example data data <- data.frame( peptide = paste0("peptide", 1:1000), pval = runif(n = 1000) ) # Plot p-values pval_distribution_plot( data = data, grouping = peptide, pval = pval )
Calculates the charge state distribution for each sample (by count or intensity).
qc_charge_states( data, sample, grouping, charge_states, intensity = NULL, remove_na_intensities = TRUE, method = "count", plot = FALSE, interactive = FALSE )qc_charge_states( data, sample, grouping, charge_states, intensity = NULL, remove_na_intensities = TRUE, method = "count", plot = FALSE, interactive = FALSE )
data |
a data frame that contains at least sample names, peptide or precursor identifiers and missed cleavage counts for each peptide or precursor. |
sample |
a character or factor column in the |
grouping |
a character column in the |
charge_states |
a character or numeric column in the |
intensity |
a numeric column in the |
remove_na_intensities |
a logical value that specifies if sample/grouping combinations with intensities that are NA (not quantified IDs) should be dropped from the data frame for analysis of missed cleavages. Default is TRUE since we are usually interested in quantifiable peptides. This is only relevant for method = "count". |
method |
a character value that indicates the method used for evaluation. "count" calculates the charge state distribution based on counts of the corresponding peptides or precursors in the charge state group, "intensity" calculates the percentage of precursors or peptides in each charge state group based on the corresponding intensity values. |
plot |
a logical value that indicates whether the result should be plotted. |
interactive |
a logical value that specifies whether the plot should be interactive (default is FALSE). |
A data frame that contains the calculated percentage made up by the sum of either all counts or intensities of peptides or precursors of the corresponding charge state (depending on which method is chosen).
# Load libraries library(dplyr) set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 100, frac_change = 0.05, n_replicates = 3, n_conditions = 2, method = "effect_random" ) %>% mutate(intensity_non_log2 = 2^peptide_intensity_missing) # Calculate charge percentages qc_charge_states( data = data, sample = sample, grouping = peptide, charge_states = charge, intensity = intensity_non_log2, method = "intensity", plot = FALSE ) # Plot charge states qc_charge_states( data = data, sample = sample, grouping = peptide, charge_states = charge, intensity = intensity_non_log2, method = "intensity", plot = TRUE )# Load libraries library(dplyr) set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 100, frac_change = 0.05, n_replicates = 3, n_conditions = 2, method = "effect_random" ) %>% mutate(intensity_non_log2 = 2^peptide_intensity_missing) # Calculate charge percentages qc_charge_states( data = data, sample = sample, grouping = peptide, charge_states = charge, intensity = intensity_non_log2, method = "intensity", plot = FALSE ) # Plot charge states qc_charge_states( data = data, sample = sample, grouping = peptide, charge_states = charge, intensity = intensity_non_log2, method = "intensity", plot = TRUE )
Calculates the percentage of contaminating proteins as the share of total intensity.
qc_contaminants( data, sample, protein, is_contaminant, intensity, n_contaminants = 5, plot = TRUE, interactive = FALSE )qc_contaminants( data, sample, protein, is_contaminant, intensity, n_contaminants = 5, plot = TRUE, interactive = FALSE )
data |
a data frame that contains at least the input variables. |
sample |
a character or factor column in the |
protein |
a character column in the |
is_contaminant |
a logical column that indicates if the protein is a contaminant. |
intensity |
a numeric column in the |
n_contaminants |
a numeric value that indicates how many contaminants should be displayed individually. The rest is combined to a group called "other". The default is 5. |
plot |
a logical value that indicates if a plot is returned. If FALSE a table is returned. |
interactive |
a logical value that indicates if the plot is made interactive using the r
package |
A bar plot that displays the percentage of contaminating proteins over all samples.
If plot = FALSE a data frame is returned.
data <- data.frame( sample = c(rep("sample_1", 10), rep("sample_2", 10)), leading_razor_protein = c(rep(c("P1", "P1", "P1", "P2", "P2", "P2", "P2", "P3", "P3", "P3"), 2)), potential_contaminant = c(rep(c(rep(TRUE, 7), rep(FALSE, 3)), 2)), intensity = c(rep(1, 2), rep(4, 4), rep(6, 4), rep(2, 3), rep(3, 5), rep(4, 2)) ) qc_contaminants( data, sample = sample, protein = leading_razor_protein, is_contaminant = potential_contaminant, intensity = intensity )data <- data.frame( sample = c(rep("sample_1", 10), rep("sample_2", 10)), leading_razor_protein = c(rep(c("P1", "P1", "P1", "P2", "P2", "P2", "P2", "P3", "P3", "P3"), 2)), potential_contaminant = c(rep(c(rep(TRUE, 7), rep(FALSE, 3)), 2)), intensity = c(rep(1, 2), rep(4, 4), rep(6, 4), rep(2, 3), rep(3, 5), rep(4, 2)) ) qc_contaminants( data, sample = sample, protein = leading_razor_protein, is_contaminant = potential_contaminant, intensity = intensity )
Calculates and plots the coefficients of variation for the selected grouping.
qc_cvs( data, grouping, condition, intensity, plot = TRUE, plot_style = "density", max_cv = 200 )qc_cvs( data, grouping, condition, intensity, plot = TRUE, plot_style = "density", max_cv = 200 )
data |
a data frame containing at least peptide, precursor or protein identifiers, information on conditions and intensity values for each peptide, precursor or protein. |
grouping |
a character column in the |
condition |
a character or factor column in the |
intensity |
a numeric column in the |
plot |
a logical value that indicates whether the result should be plotted. |
plot_style |
a character value that indicates the plotting style. |
max_cv |
a numeric value that specifies the maximum percentage of CVs that should be included
in the returned plot. The default value is |
Either a data frame with the median CVs in % or a plot showing the distribution of the CVs is returned.
# Load libraries library(dplyr) set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 100, frac_change = 0.05, n_replicates = 3, n_conditions = 2, method = "effect_random" ) %>% mutate(intensity_non_log2 = 2^peptide_intensity_missing) # Calculate coefficients of variation qc_cvs( data = data, grouping = peptide, condition = condition, intensity = intensity_non_log2, plot = FALSE ) # Plot coefficients of variation # Different plot styles are available qc_cvs( data = data, grouping = peptide, condition = condition, intensity = intensity_non_log2, plot = TRUE, plot_style = "violin" )# Load libraries library(dplyr) set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 100, frac_change = 0.05, n_replicates = 3, n_conditions = 2, method = "effect_random" ) %>% mutate(intensity_non_log2 = 2^peptide_intensity_missing) # Calculate coefficients of variation qc_cvs( data = data, grouping = peptide, condition = condition, intensity = intensity_non_log2, plot = FALSE ) # Plot coefficients of variation # Different plot styles are available qc_cvs( data = data, grouping = peptide, condition = condition, intensity = intensity_non_log2, plot = TRUE, plot_style = "violin" )
Calculates the percentage of data completeness. That means, what percentage of all detected precursors is present in each sample.
qc_data_completeness( data, sample, grouping, intensity, digestion = NULL, plot = TRUE, interactive = FALSE )qc_data_completeness( data, sample, grouping, intensity, digestion = NULL, plot = TRUE, interactive = FALSE )
data |
a data frame containing at least the input variables. |
sample |
a character or factor column in the |
grouping |
a character column in the |
intensity |
a numeric column in the |
digestion |
optional, a character column in the |
plot |
a logical value that indicates whether the result should be plotted. |
interactive |
a logical value that specifies whether the plot should be interactive (default is FALSE). |
A bar plot that displays the percentage of data completeness over all samples.
If plot = FALSE a data frame is returned. If interactive = TRUE, the plot is
interactive.
set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 100, frac_change = 0.05, n_replicates = 3, n_conditions = 2, method = "effect_random" ) # Determine data completeness qc_data_completeness( data = data, sample = sample, grouping = peptide, intensity = peptide_intensity_missing, plot = FALSE ) # Plot data completeness qc_data_completeness( data = data, sample = sample, grouping = peptide, intensity = peptide_intensity_missing, plot = TRUE )set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 100, frac_change = 0.05, n_replicates = 3, n_conditions = 2, method = "effect_random" ) # Determine data completeness qc_data_completeness( data = data, sample = sample, grouping = peptide, intensity = peptide_intensity_missing, plot = FALSE ) # Plot data completeness qc_data_completeness( data = data, sample = sample, grouping = peptide, intensity = peptide_intensity_missing, plot = TRUE )
Returns a plot or table of the number of IDs for each sample. The default settings remove grouping variables without quantitative information (intensity is NA). These will not be counted as IDs.
qc_ids( data, sample, grouping, intensity, remove_na_intensities = TRUE, condition = NULL, title = "ID count per sample", plot = TRUE, interactive = FALSE )qc_ids( data, sample, grouping, intensity, remove_na_intensities = TRUE, condition = NULL, title = "ID count per sample", plot = TRUE, interactive = FALSE )
data |
a data frame containing at least sample names and precursor/peptide/protein IDs. |
sample |
a character or factor column in the |
grouping |
a character column in the |
intensity |
a character column in the |
remove_na_intensities |
a logical value that specifies if sample/grouping combinations with intensities that are NA (not quantified IDs) should be dropped from the data frame. Default is TRUE since we are usually interested in the number of quantifiable IDs. |
condition |
optional, a column in the |
title |
optional, a character value that specifies the plot title (default is "ID count per sample"). |
plot |
a logical value that indicates whether the result should be plotted. |
interactive |
a logical value that specifies whether the plot should be interactive (default is FALSE). |
A bar plot with the height corresponding to the number of IDs, each bar represents one
sample (if plot = TRUE). If plot = FALSE a table with ID counts is returned.
set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 100, frac_change = 0.05, n_replicates = 3, n_conditions = 2, method = "effect_random" ) # Calculate number of identifications qc_ids( data = data, sample = sample, grouping = peptide, intensity = peptide_intensity_missing, condition = condition, plot = FALSE ) # Plot number of identifications qc_ids( data = data, sample = sample, grouping = peptide, intensity = peptide_intensity_missing, condition = condition, plot = TRUE )set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 100, frac_change = 0.05, n_replicates = 3, n_conditions = 2, method = "effect_random" ) # Calculate number of identifications qc_ids( data = data, sample = sample, grouping = peptide, intensity = peptide_intensity_missing, condition = condition, plot = FALSE ) # Plot number of identifications qc_ids( data = data, sample = sample, grouping = peptide, intensity = peptide_intensity_missing, condition = condition, plot = TRUE )
Plots the overall or sample-wise distribution of all peptide intensities as a boxplot or histogram.
qc_intensity_distribution( data, sample = NULL, grouping, intensity_log2, plot_style )qc_intensity_distribution( data, sample = NULL, grouping, intensity_log2, plot_style )
data |
a data frame that contains at least sample names, grouping identifiers (precursor, peptide or protein) and log2 transformed intensities for each grouping identifier. |
sample |
an optional character or factor column in the |
grouping |
a character column in the |
intensity_log2 |
a numeric column in the |
plot_style |
a character value that indicates the plot type. This can be either "histogram", "boxplot" or "violin". Plot style "boxplot" and "violin" can only be used if a sample column is provided. |
A histogram or boxplot that shows the intensity distribution over all samples or by sample.
set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 100, frac_change = 0.05, n_replicates = 3, n_conditions = 2, method = "effect_random" ) # Plot intensity distribution # The plot style can be changed qc_intensity_distribution( data = data, sample = sample, grouping = peptide, intensity_log2 = peptide_intensity_missing, plot_style = "boxplot" )set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 100, frac_change = 0.05, n_replicates = 3, n_conditions = 2, method = "effect_random" ) # Plot intensity distribution # The plot style can be changed qc_intensity_distribution( data = data, sample = sample, grouping = peptide, intensity_log2 = peptide_intensity_missing, plot_style = "boxplot" )
Median intensities per run are returned either as a plot or a table.
qc_median_intensities( data, sample, grouping, intensity, plot = TRUE, interactive = FALSE )qc_median_intensities( data, sample, grouping, intensity, plot = TRUE, interactive = FALSE )
data |
a data frame that contains at least the input variables. |
sample |
a character or factor column in the |
grouping |
a character column in the |
intensity |
a numeric column in the |
plot |
a logical value that indicates whether the result should be plotted. |
interactive |
a logical value that specifies whether the plot should be interactive (default is FALSE). |
A plot that displays median intensity over all samples. If plot = FALSE a data
frame containing median intensities is returned.
set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 100, frac_change = 0.05, n_replicates = 3, n_conditions = 2, method = "effect_random" ) # Calculate median intensities qc_median_intensities( data = data, sample = sample, grouping = peptide, intensity = peptide_intensity_missing, plot = FALSE ) # Plot median intensities qc_median_intensities( data = data, sample = sample, grouping = peptide, intensity = peptide_intensity_missing, plot = TRUE )set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 100, frac_change = 0.05, n_replicates = 3, n_conditions = 2, method = "effect_random" ) # Calculate median intensities qc_median_intensities( data = data, sample = sample, grouping = peptide, intensity = peptide_intensity_missing, plot = FALSE ) # Plot median intensities qc_median_intensities( data = data, sample = sample, grouping = peptide, intensity = peptide_intensity_missing, plot = TRUE )
Calculates the percentage of missed cleavages for each sample (by count or intensity). The default settings remove grouping variables without quantitative information (intensity is NA). These will not be used for the calculation of missed cleavage percentages.
qc_missed_cleavages( data, sample, grouping, missed_cleavages, intensity, remove_na_intensities = TRUE, method = "count", plot = FALSE, interactive = FALSE )qc_missed_cleavages( data, sample, grouping, missed_cleavages, intensity, remove_na_intensities = TRUE, method = "count", plot = FALSE, interactive = FALSE )
data |
a data frame containing at least sample names, peptide or precursor identifiers and missed cleavage counts for each peptide or precursor. |
sample |
a character or factor column in the |
grouping |
a character column in the |
missed_cleavages |
a numeric column in the |
intensity |
a numeric column in the |
remove_na_intensities |
a logical value that specifies if sample/grouping combinations with intensities that are NA (not quantified IDs) should be dropped from the data frame for analysis of missed cleavages. Default is TRUE since we are usually interested in quantifiable peptides. This is only relevant for method = "count". |
method |
a character value that indicates the method used for evaluation. "count" calculates the percentage of missed cleavages based on counts of the corresponding peptide or precursor, "intensity" calculates the percentage of missed cleavages by intensity of the corresponding peptide or precursor. |
plot |
a logical value that indicates whether the result should be plotted. |
interactive |
a logical value that specifies whether the plot should be interactive (default is FALSE). |
A data frame that contains the calculated percentage made up by the sum of all peptides or precursors containing the corresponding amount of missed cleavages.
library(dplyr) set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 100, frac_change = 0.05, n_replicates = 3, n_conditions = 2, method = "effect_random" ) %>% mutate(intensity_non_log2 = 2^peptide_intensity_missing) # Calculate missed cleavage percentages qc_missed_cleavages( data = data, sample = sample, grouping = peptide, missed_cleavages = n_missed_cleavage, intensity = intensity_non_log2, method = "intensity", plot = FALSE ) # Plot missed cleavages qc_missed_cleavages( data = data, sample = sample, grouping = peptide, missed_cleavages = n_missed_cleavage, intensity = intensity_non_log2, method = "intensity", plot = TRUE )library(dplyr) set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 100, frac_change = 0.05, n_replicates = 3, n_conditions = 2, method = "effect_random" ) %>% mutate(intensity_non_log2 = 2^peptide_intensity_missing) # Calculate missed cleavage percentages qc_missed_cleavages( data = data, sample = sample, grouping = peptide, missed_cleavages = n_missed_cleavage, intensity = intensity_non_log2, method = "intensity", plot = FALSE ) # Plot missed cleavages qc_missed_cleavages( data = data, sample = sample, grouping = peptide, missed_cleavages = n_missed_cleavage, intensity = intensity_non_log2, method = "intensity", plot = TRUE )
Plots a principal component analysis based on peptide or precursor intensities.
qc_pca( data, sample, grouping, intensity, condition, components = c("PC1", "PC2"), digestion = NULL, plot_style = "pca" )qc_pca( data, sample, grouping, intensity, condition, components = c("PC1", "PC2"), digestion = NULL, plot_style = "pca" )
data |
a data frame that contains sample names, peptide or precursor identifiers, corresponding intensities and a condition column indicating e.g. the treatment. |
sample |
a character column in the |
grouping |
a character column in the |
intensity |
a numeric column in the |
condition |
a numeric or character column in the |
components |
a character vector indicating the two components that should be displayed in the plot. By default these are PC1 and PC2. You can provide these using a character vector of the form c("PC1", "PC2"). |
digestion |
optional, a character column in the |
plot_style |
a character value that specifies what plot should be returned. If
|
A principal component analysis plot showing PC1 and PC2. If plot_style = "scree", a
scree plot for all dimensions is returned.
set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 100, frac_change = 0.05, n_replicates = 3, n_conditions = 2, ) # Plot scree plot qc_pca( data = data, sample = sample, grouping = peptide, intensity = peptide_intensity_missing, condition = condition, plot_style = "scree" ) # Plot principal components qc_pca( data = data, sample = sample, grouping = peptide, intensity = peptide_intensity_missing, condition = condition )set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 100, frac_change = 0.05, n_replicates = 3, n_conditions = 2, ) # Plot scree plot qc_pca( data = data, sample = sample, grouping = peptide, intensity = peptide_intensity_missing, condition = condition, plot_style = "scree" ) # Plot principal components qc_pca( data = data, sample = sample, grouping = peptide, intensity = peptide_intensity_missing, condition = condition )
Plots one minute binned median precursor elution peak width over retention time for each sample.
qc_peak_width( data, sample, intensity, retention_time, peak_width = NULL, retention_time_start = NULL, retention_time_end = NULL, remove_na_intensities = TRUE, interactive = FALSE )qc_peak_width( data, sample, intensity, retention_time, peak_width = NULL, retention_time_start = NULL, retention_time_end = NULL, remove_na_intensities = TRUE, interactive = FALSE )
data |
a data frame containing at least sample names and protein IDs. |
sample |
a character column in the |
intensity |
a numeric column in the |
retention_time |
a numeric column in the |
peak_width |
a numeric column in the |
retention_time_start |
a numeric column in the |
retention_time_end |
a numeric column in the |
remove_na_intensities |
a logical value that specifies if sample/grouping combinations with intensities that are NA (not quantified IDs) should be dropped from the data frame. Default is TRUE since we are usually interested in the peak width of quantifiable data. |
interactive |
a logical value that specifies whether the plot should be interactive (default is FALSE). |
A line plot displaying one minute binned median precursor elution peak width over retention time for each sample.
data <- data.frame( r_file_name = c(rep("sample_1", 10), rep("sample2", 10)), fg_quantity = c(rep(2000, 20)), eg_mean_apex_rt = c(rep(c(1, 2, 3, 4, 5, 6, 7, 8, 9, 10), 2)), eg_start_rt = c(0.5, 1, 3, 4, 5, 6, 7, 7.5, 8, 9, 1, 2, 2, 3, 4, 5, 5, 8, 9, 9), eg_end_rt = c( 1.5, 2, 3.1, 4.5, 5.8, 6.6, 8, 8, 8.4, 9.1, 3, 2.2, 4, 3.4, 4.5, 5.5, 5.6, 8.3, 10, 12 ) ) qc_peak_width( data, sample = r_file_name, intensity = fg_quantity, retention_time = eg_mean_apex_rt, retention_time_start = eg_start_rt, retention_time_end = eg_end_rt )data <- data.frame( r_file_name = c(rep("sample_1", 10), rep("sample2", 10)), fg_quantity = c(rep(2000, 20)), eg_mean_apex_rt = c(rep(c(1, 2, 3, 4, 5, 6, 7, 8, 9, 10), 2)), eg_start_rt = c(0.5, 1, 3, 4, 5, 6, 7, 7.5, 8, 9, 1, 2, 2, 3, 4, 5, 5, 8, 9, 9), eg_end_rt = c( 1.5, 2, 3.1, 4.5, 5.8, 6.6, 8, 8, 8.4, 9.1, 3, 2.2, 4, 3.4, 4.5, 5.5, 5.6, 8.3, 10, 12 ) ) qc_peak_width( data, sample = r_file_name, intensity = fg_quantity, retention_time = eg_mean_apex_rt, retention_time_start = eg_start_rt, retention_time_end = eg_end_rt )
Calculates the percentage share of each peptide types (fully-tryptic, semi-tryptic, non-tryptic) for each sample.
qc_peptide_type( data, sample, peptide, pep_type, intensity, remove_na_intensities = TRUE, method = "count", plot = FALSE, interactive = FALSE )qc_peptide_type( data, sample, peptide, pep_type, intensity, remove_na_intensities = TRUE, method = "count", plot = FALSE, interactive = FALSE )
data |
a data frame that contains at least the input columns. |
sample |
a character or factor column in the |
peptide |
a character column in the |
pep_type |
a character column in the |
intensity |
a numeric column in the |
remove_na_intensities |
a logical value that specifies if sample/peptide combinations with intensities that are NA (not quantified IDs) should be dropped from the data frame for analysis of peptide type distributions. Default is TRUE since we are usually interested in the peptide type distribution of quantifiable IDs. This is only relevant for method = "count". |
method |
a character value that indicates the method used for evaluation.
|
plot |
a logical value that indicates whether the result should be plotted. |
interactive |
a logical value that indicates whether the plot should be interactive. |
A data frame that contains the calculated percentage shares of each peptide type per
sample. The count column contains the number of peptides with a specific type. The
peptide_type_percent column contains the percentage share of a specific peptide type.
# Load libraries library(dplyr) set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 100, frac_change = 0.05, n_replicates = 3, n_conditions = 2, method = "effect_random" ) %>% mutate(intensity_non_log2 = 2^peptide_intensity_missing) # Determine peptide type percentages qc_peptide_type( data = data, sample = sample, peptide = peptide, pep_type = pep_type, intensity = intensity_non_log2, method = "intensity", plot = FALSE ) # Plot peptide type qc_peptide_type( data = data, sample = sample, peptide = peptide, pep_type = pep_type, intensity = intensity_non_log2, method = "intensity", plot = TRUE )# Load libraries library(dplyr) set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 100, frac_change = 0.05, n_replicates = 3, n_conditions = 2, method = "effect_random" ) %>% mutate(intensity_non_log2 = 2^peptide_intensity_missing) # Determine peptide type percentages qc_peptide_type( data = data, sample = sample, peptide = peptide, pep_type = pep_type, intensity = intensity_non_log2, method = "intensity", plot = FALSE ) # Plot peptide type qc_peptide_type( data = data, sample = sample, peptide = peptide, pep_type = pep_type, intensity = intensity_non_log2, method = "intensity", plot = TRUE )
Calculates the proteome coverage for each samples and for all samples combined. In other words t he fraction of detected proteins to all proteins in the proteome is calculated.
qc_proteome_coverage( data, sample, protein_id, organism_id, reviewed = TRUE, plot = TRUE, interactive = FALSE )qc_proteome_coverage( data, sample, protein_id, organism_id, reviewed = TRUE, plot = TRUE, interactive = FALSE )
data |
a data frame that contains at least sample names and protein ID's. |
sample |
a character column in the |
protein_id |
a character or numeric column in the |
organism_id |
a numeric value that specifies a NCBI taxonomy identifier (TaxId) of the organism used. Human: 9606, S. cerevisiae: 559292, E. coli: 83333. |
reviewed |
a logical value that determines if only reviewed protein entries will be considered as the full proteome. Default is TRUE. |
plot |
a logical value that specifies whether the result should be plotted. |
interactive |
a logical value that indicates whether the plot should be interactive (default is FALSE). |
A bar plot showing the percentage of of the proteome detected and undetected in total
and for each sample. If plot = FALSE a data frame containing the numbers is returned.
# Create example data proteome <- data.frame(id = 1:4518) data <- data.frame( sample = c(rep("A", 101), rep("B", 1000), rep("C", 1000)), protein_id = c(proteome$id[1:100], proteome$id[1:1000], proteome$id[1000:2000]) ) # Calculate proteome coverage qc_proteome_coverage( data = data, sample = sample, protein_id = protein_id, organism_id = 83333, plot = FALSE ) # Plot proteome coverage qc_proteome_coverage( data = data, sample = sample, protein_id = protein_id, organism_id = 83333, plot = TRUE )# Create example data proteome <- data.frame(id = 1:4518) data <- data.frame( sample = c(rep("A", 101), rep("B", 1000), rep("C", 1000)), protein_id = c(proteome$id[1:100], proteome$id[1:1000], proteome$id[1000:2000]) ) # Calculate proteome coverage qc_proteome_coverage( data = data, sample = sample, protein_id = protein_id, organism_id = 83333, plot = FALSE ) # Plot proteome coverage qc_proteome_coverage( data = data, sample = sample, protein_id = protein_id, organism_id = 83333, plot = TRUE )
Calculates and plots ranked intensities for proteins, peptides or precursors.
qc_ranked_intensities( data, sample, grouping, intensity_log2, facet = FALSE, plot = FALSE, y_axis_transformation = "log10", interactive = FALSE )qc_ranked_intensities( data, sample, grouping, intensity_log2, facet = FALSE, plot = FALSE, y_axis_transformation = "log10", interactive = FALSE )
data |
a data frame that contains at least sample names, grouping identifiers (precursor, peptide or protein) and log2 transformed intensities for each grouping identifier. |
sample |
a character column in the |
grouping |
a character column in the |
intensity_log2 |
a numeric column in the |
facet |
a logical value that specifies whether the calculation should be done group wise by
sample and if the resulting plot should be faceted by sample. (default is |
plot |
a logical value that specifies whether the result should be plotted (default is |
y_axis_transformation |
a character value that determines that y-axis transformation. The value is either "log2" or "log10" (default is "log10"). |
interactive |
a logical value that specifies whether the plot should be interactive
(default is |
A data frame containing the ranked intensities is returned. If plot = TRUE a plot
is returned. The intensities are log10 transformed for the plot.
set.seed(123) # Makes example reproducible # Create synthetic data data <- create_synthetic_data( n_proteins = 50, frac_change = 0.05, n_replicates = 4, n_conditions = 3, method = "effect_random", additional_metadata = FALSE ) # Plot ranked intensities for all samples combined qc_ranked_intensities( data = data, sample = sample, grouping = peptide, intensity_log2 = peptide_intensity, plot = TRUE, ) # Plot ranked intensities for each sample separately qc_ranked_intensities( data = data, sample = sample, grouping = peptide, intensity_log2 = peptide_intensity, plot = TRUE, facet = TRUE )set.seed(123) # Makes example reproducible # Create synthetic data data <- create_synthetic_data( n_proteins = 50, frac_change = 0.05, n_replicates = 4, n_conditions = 3, method = "effect_random", additional_metadata = FALSE ) # Plot ranked intensities for all samples combined qc_ranked_intensities( data = data, sample = sample, grouping = peptide, intensity_log2 = peptide_intensity, plot = TRUE, ) # Plot ranked intensities for each sample separately qc_ranked_intensities( data = data, sample = sample, grouping = peptide, intensity_log2 = peptide_intensity, plot = TRUE, facet = TRUE )
A correlation heatmap is created that uses hirachical clustering to determine sample similarity.
qc_sample_correlation( data, sample, grouping, intensity_log2, condition, digestion = NULL, run_order = NULL, method = "spearman", interactive = FALSE )qc_sample_correlation( data, sample, grouping, intensity_log2, condition, digestion = NULL, run_order = NULL, method = "spearman", interactive = FALSE )
data |
a data frame that contains at least the input variables. |
sample |
a character column in the |
grouping |
a character column in the |
intensity_log2 |
a numeric column in the |
condition |
a character or numeric column in the |
digestion |
optional, a character column in the |
run_order |
optional, a character or numeric column in the |
method |
a character value that specifies the method to be used for correlation.
|
interactive |
a logical value that specifies whether the plot should be interactive.
Determines if an interactive or static heatmap should be created using |
A correlation heatmap that compares each sample. The dendrogram is sorted by optimal leaf ordering.
set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 100, frac_change = 0.05, n_replicates = 3, n_conditions = 2, method = "effect_random" ) # Create sample correlation heatmap qc_sample_correlation( data = data, sample = sample, grouping = peptide, intensity_log2 = peptide_intensity_missing, condition = condition )set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 100, frac_change = 0.05, n_replicates = 3, n_conditions = 2, method = "effect_random" ) # Create sample correlation heatmap qc_sample_correlation( data = data, sample = sample, grouping = peptide, intensity_log2 = peptide_intensity_missing, condition = condition )
Plots the distribution of protein coverages in a histogram.
qc_sequence_coverage( data, protein_identifier, coverage, sample = NULL, interactive = FALSE )qc_sequence_coverage( data, protein_identifier, coverage, sample = NULL, interactive = FALSE )
data |
a data frame that contains at least the input variables. |
protein_identifier |
a character column in the |
coverage |
a numeric column in the |
sample |
optional, a character or factor column in the |
interactive |
a logical value that specifies whether the plot should be interactive (default is FALSE). |
A protein coverage histogram with 5 percent binwidth. The vertical dotted line indicates the median.
set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 100, frac_change = 0.05, n_replicates = 3, n_conditions = 2, method = "effect_random" ) # Plot sequence coverage qc_sequence_coverage( data = data, protein_identifier = protein, coverage = coverage )set.seed(123) # Makes example reproducible # Create example data data <- create_synthetic_data( n_proteins = 100, frac_change = 0.05, n_replicates = 3, n_conditions = 2, method = "effect_random" ) # Plot sequence coverage qc_sequence_coverage( data = data, protein_identifier = protein, coverage = coverage )
This function randomises the order of samples in an MS queue. QC and Blank samples are left in
place. It is also possible to randomise only parts of the queue. Before running this make sure
to set a specific seed with the
set.seed() function. This ensures that the randomisation
of the result is consistent if the function is run again.
randomise_queue(data = NULL, rows = NULL, export = FALSE)randomise_queue(data = NULL, rows = NULL, export = FALSE)
data |
optional, a data frame that contains a queue. If not provided a queue file can be chosen interactively. |
rows |
optional, a numeric vector that specifies a range of rows in for which samples should be randomized. |
export |
a logical value that determines if a |
If export = TRUE a "randomised_queue.csv" file will be saved in the
working directory. If export = FALSE a data frame that contains the randomised queue
is returned.
queue <- create_queue( date = c("200722"), instrument = c("EX1"), user = c("jquast"), measurement_type = c("DIA"), experiment_name = c("JPQ031"), digestion = c("LiP", "tryptic control"), treatment_type_1 = c("EDTA", "H2O"), treatment_type_2 = c("Zeba", "unfiltered"), treatment_dose_1 = c(10, 30, 60), treatment_unit_1 = c("min"), n_replicates = 4, number_runs = FALSE, organism = c("E. coli"), exclude_combinations = list(list( treatment_type_1 = c("H2O"), treatment_type_2 = c("Zeba", "unfiltered"), treatment_dose_1 = c(10, 30) )), inj_vol = c(2), data_path = "D:\\2007_Data", method_path = "C:\\Xcalibur\\methods\\DIA_120min", position_row = c("A", "B", "C", "D", "E", "F"), position_column = 8, blank_every_n = 4, blank_position = "1-V1", blank_method_path = "C:\\Xcalibur\\methods\\blank" ) head(queue, n = 20) randomised_queue <- randomise_queue( data = queue, export = FALSE ) head(randomised_queue, n = 20)queue <- create_queue( date = c("200722"), instrument = c("EX1"), user = c("jquast"), measurement_type = c("DIA"), experiment_name = c("JPQ031"), digestion = c("LiP", "tryptic control"), treatment_type_1 = c("EDTA", "H2O"), treatment_type_2 = c("Zeba", "unfiltered"), treatment_dose_1 = c(10, 30, 60), treatment_unit_1 = c("min"), n_replicates = 4, number_runs = FALSE, organism = c("E. coli"), exclude_combinations = list(list( treatment_type_1 = c("H2O"), treatment_type_2 = c("Zeba", "unfiltered"), treatment_dose_1 = c(10, 30) )), inj_vol = c(2), data_path = "D:\\2007_Data", method_path = "C:\\Xcalibur\\methods\\DIA_120min", position_row = c("A", "B", "C", "D", "E", "F"), position_column = 8, blank_every_n = 4, blank_position = "1-V1", blank_method_path = "C:\\Xcalibur\\methods\\blank" ) head(queue, n = 20) randomised_queue <- randomise_queue( data = queue, export = FALSE ) head(randomised_queue, n = 20)
Rapamycin example data used for the vignette about binary control/treated data. The data was obtained from Piazza 2020 and corresponds to experiment 18. FKBP1A the rapamycin binding protein and 49 other randomly sampled proteins were used for this example dataset. Furthermore, only the DMSO control and the 10 uM condition were used.
rapamycin_10uMrapamycin_10uM
A data frame containing peptide level data from a Spectronaut report.
Piazza, I., Beaton, N., Bruderer, R. et al. A machine learning-based chemoproteomic approach to identify drug targets and binding sites in complex proteomes. Nat Commun 11, 4200 (2020). doi:10.1038/s41467-020-18071-x
Rapamycin example data used for the vignette about dose response data. The data was obtained from Piazza 2020 and corresponds to experiment 18. FKBP1A the rapamycin binding protein and 39 other randomly sampled proteins were used for this example dataset. The concentration range includes the following points: 0 (DMSO control), 10 pM, 100 pM, 1 nM, 10 nM, 100 nM, 1 uM, 10 uM and 100 uM.
rapamycin_dose_responserapamycin_dose_response
A data frame containing peptide level data from a Spectronaut report.
Piazza, I., Beaton, N., Bruderer, R. et al. A machine learning-based chemoproteomic approach to identify drug targets and binding sites in complex proteomes. Nat Commun 11, 4200 (2020). doi:10.1038/s41467-020-18071-x
The function uses the very fast fread function form the data.table package. The
column names of the resulting data table are made more r-friendly using clean_names from
the janitor package. It replaces "." and " " with "_" and converts names to lower case
which is also known as snake_case. In the end the data table is converted to a tibble.
read_protti(filename, ...)read_protti(filename, ...)
filename |
a character value that specifies the path to the file. |
... |
additional arguments for the fread function. |
A data frame (with class tibble) that contains the content of the specified file.
## Not run: read_protti("folder\\filename") ## End(Not run)## Not run: read_protti("folder\\filename") ## End(Not run)
Helper function for the calculation of sequence coverage, replaces identified positions with an "x" within the protein sequence.
replace_identified_by_x(sequence, positions_start, positions_end)replace_identified_by_x(sequence, positions_start, positions_end)
sequence |
a character value that contains the protein sequence. |
positions_start |
a numeric vector of start positions of the identified peptides. |
positions_end |
a numeric vector of end positions of the identified peptides. |
A character vector that contains the modified protein sequence with each identified position replaced by "x".
scale_protti is used to scale a numeric vector either between 0 and 1 or around a
centered value using the standard deviation. If a vector containing only one value or
repeatedly the same value is provided, 1 is returned as the scaled value for method = "01"
and 0 is returned for metod = "center".
scale_protti(x, method, default_to_high = TRUE)scale_protti(x, method, default_to_high = TRUE)
x |
a numeric vector |
method |
a character value that specifies the method to be used for scaling. "01" scales
the vector between 0 and 1. "center" scales the vector equal to |
default_to_high |
if there is only one number in the vector the "01" method will default to scale this to 1. If this argument is set to FALSE it will be scaled to 0 instead. |
A scaled numeric vector.
scale_protti(c(1, 2, 1, 4, 6, 8), method = "01")scale_protti(c(1, 2, 1, 4, 6, 8), method = "01")
Converts a vector of metal names extracted from the ft_metal column
obtained with fetch_uniprot to a pattern that can be used to search for corresponding
ChEBI IDs. This is used as a helper function for other functions.
split_metal_name(metal_names)split_metal_name(metal_names)
metal_names |
a character vector containing names of metals and metal containing molecules. |
A character vector with metal name search patterns.
Downloads data table from URL. If an error occurs during the query (for example due to no connection) the function waits 3 seconds and tries again. If no result could be obtained after the given number of tries a message indicating the problem is returned.
try_query( url, max_tries = 5, silent = TRUE, type = "text/tab-separated-values", timeout = 60, accept = NULL, ... )try_query( url, max_tries = 5, silent = TRUE, type = "text/tab-separated-values", timeout = 60, accept = NULL, ... )
url |
a character value of an URL to the website that contains the table that should be downloaded. |
max_tries |
a numeric value that specifies the number of times the function tries to download the data in case an error occurs. Default is 5. |
silent |
a logical value that specifies if individual messages are printed after each try that failed. |
type |
a character value that specifies the type of data at the target URL. Options are all options that can be supplied to httr::content, these include e.g. "text/tab-separated-values", "application/json" and "txt/csv". Default is "text/tab-separated-values". |
timeout |
a numeric value that specifies the maximum request time. Default is 60 seconds. |
accept |
a character value that specifies the type of data that should be sent by the API if it uses content negotiation. The default is NULL and it should only be set for APIs that use content negotiation. |
... |
other parameters supplied to the parsing function used by httr::content. |
A data frame that contains the table from the url.
Performs a Welch's t-test and calculates p-values between two groups.
ttest_protti(mean1, mean2, sd1, sd2, n1, n2, log_values = TRUE)ttest_protti(mean1, mean2, sd1, sd2, n1, n2, log_values = TRUE)
mean1 |
a numeric vector that contains the means of group1. |
mean2 |
a numeric vector that contains the means of group2. |
sd1 |
a numeric vector that contains the standard deviations of group1. |
sd2 |
a numeric vector that contains the standard deviations of group2. |
n1 |
a numeric vector that contains the number of replicates used for the calculation of each mean and standard deviation of group1. |
n2 |
a numeric vector that contains the number of replicates used for the calculation of each mean and standard deviation of group2. |
log_values |
a logical value that indicates if values are log transformed. This determines
how fold changes are calculated. Default is |
A data frame that contains the calculated differences of means, standard error, t statistic and p-values.
ttest_protti( mean1 = 10, mean2 = 15.5, sd1 = 1, sd2 = 0.5, n1 = 3, n2 = 3 )ttest_protti( mean1 = 10, mean2 = 15.5, sd1 = 1, sd2 = 0.5, n1 = 3, n2 = 3 )
A colour scheme by the viridis colour scheme from the viridis R package.
viridis_coloursviridis_colours
A vector containing 256 colours
viridis R package, created by Stéfan van der Walt (stefanv) and Nathaniel Smith (njsmith)
Plots a volcano plot for the given input.
volcano_plot( data, grouping, log2FC, significance, method, target_column = NULL, target = NULL, facet_by = NULL, facet_scales = "fixed", title = "Volcano plot", x_axis_label = "log2(fold change)", y_axis_label = "-log10(p-value)", legend_label = "Target", colour = NULL, log2FC_cutoff = 1, significance_cutoff = 0.01, interactive = FALSE )volcano_plot( data, grouping, log2FC, significance, method, target_column = NULL, target = NULL, facet_by = NULL, facet_scales = "fixed", title = "Volcano plot", x_axis_label = "log2(fold change)", y_axis_label = "-log10(p-value)", legend_label = "Target", colour = NULL, log2FC_cutoff = 1, significance_cutoff = 0.01, interactive = FALSE )
data |
a data frame that contains at least the input variables. |
grouping |
a character column in the |
log2FC |
a character column in the |
significance |
a character column in the |
method |
a character value that specifies the method used for the plot.
|
target_column |
optional, a column required for |
target |
optional, a vector required for |
facet_by |
optional, a character column that contains information by which the data should be faceted into multiple plots. |
facet_scales |
a character value that specifies if the scales should be "free", "fixed",
"free_x" or "free_y", if a faceted plot is created. These inputs are directly supplied to the
|
title |
optional, a character value that specifies the title of the volcano plot. Default is "Volcano plot". |
x_axis_label |
optional, a character value that specifies the x-axis label. Default is "log2(fold change)". |
y_axis_label |
optional, a character value that specifies the y-axis label. Default is "-log10(q-value)". |
legend_label |
optional, a character value that specifies the legend label. Default is "Target". |
colour |
optional, a character vector containing colours that should be used to colour
points according to the selected method. IMPORTANT: the first value in the vector is the
default point colour, the additional values specify colouring of target or significant points.
E.g. |
log2FC_cutoff |
optional, a numeric value that specifies the log2 transformed fold change cutoff used for the vertical lines, which can be used to assess the significance of changes. Default value is 1. |
significance_cutoff |
optional, a character vector that specifies the p-value cutoff used
for the horizontal cutoff line, which can be used to assess the significance of changes. The
vector can consist solely of one element, which is the cutoff value. In that case the cutoff
will be applied directly to the plot. Alternatively, a second element can be provided to the
vector that specifies a column in the |
interactive |
a logical value that specifies whether the plot should be interactive (default is FALSE). |
Depending on the method used a volcano plot with either highlighted targets
(method = "target") or highlighted significant proteins (method = "significant")
is returned.
set.seed(123) # Makes example reproducible # Create synthetic data data <- create_synthetic_data( n_proteins = 10, frac_change = 0.5, n_replicates = 4, n_conditions = 3, method = "effect_random", additional_metadata = FALSE ) # Assign missingness information data_missing <- assign_missingness( data, sample = sample, condition = condition, grouping = peptide, intensity = peptide_intensity_missing, ref_condition = "all", retain_columns = c(protein, change_peptide) ) # Calculate differential abundances diff <- calculate_diff_abundance( data = data_missing, sample = sample, condition = condition, grouping = peptide, intensity_log2 = peptide_intensity_missing, missingness = missingness, comparison = comparison, method = "t-test", retain_columns = c(protein, change_peptide) ) volcano_plot( data = diff, grouping = peptide, log2FC = diff, significance = pval, method = "target", target_column = change_peptide, target = TRUE, facet_by = comparison, significance_cutoff = c(0.05, "adj_pval") )set.seed(123) # Makes example reproducible # Create synthetic data data <- create_synthetic_data( n_proteins = 10, frac_change = 0.5, n_replicates = 4, n_conditions = 3, method = "effect_random", additional_metadata = FALSE ) # Assign missingness information data_missing <- assign_missingness( data, sample = sample, condition = condition, grouping = peptide, intensity = peptide_intensity_missing, ref_condition = "all", retain_columns = c(protein, change_peptide) ) # Calculate differential abundances diff <- calculate_diff_abundance( data = data_missing, sample = sample, condition = condition, grouping = peptide, intensity_log2 = peptide_intensity_missing, missingness = missingness, comparison = comparison, method = "t-test", retain_columns = c(protein, change_peptide) ) volcano_plot( data = diff, grouping = peptide, log2FC = diff, significance = pval, method = "target", target_column = change_peptide, target = TRUE, facet_by = comparison, significance_cutoff = c(0.05, "adj_pval") )
Creates a Woods' plot that plots log2 fold change of peptides or precursors along the protein sequence. The peptides or precursors are located on the x-axis based on their start and end positions. The position on the y-axis displays the fold change. The vertical size (y-axis) of the box representing the peptides or precursors do not have any meaning.
woods_plot( data, fold_change, start_position, end_position, protein_length, coverage = NULL, protein_id, targets = "all", facet = TRUE, colouring = NULL, fold_change_cutoff = 1, highlight = NULL, export = FALSE, export_name = "woods_plots" )woods_plot( data, fold_change, start_position, end_position, protein_length, coverage = NULL, protein_id, targets = "all", facet = TRUE, colouring = NULL, fold_change_cutoff = 1, highlight = NULL, export = FALSE, export_name = "woods_plots" )
data |
a data frame that contains differential abundance, start and end peptide or precursor positions, protein length and optionally a variable based on which peptides or precursors should be coloured. |
fold_change |
a numeric column in the |
start_position |
a numeric column in the |
end_position |
a numeric column in the |
protein_length |
a numeric column in the |
coverage |
optional, a numeric column in the |
protein_id |
a character column in the |
targets |
a character vector that specifies the identifiers of the proteins (depending on
|
facet |
a logical value that indicates if plots should be summarised into facets of 20
plots. This is recommended for many plots. Default is |
colouring |
optional, a character or numeric (discrete or continous) column in the data frame containing information by which peptide or precursors should be coloured. |
fold_change_cutoff |
optional, a numeric value that specifies the log2 fold change cutoff used in the plot. The default value is 2. |
highlight |
optional, a logical column that specifies whether specific peptides or precursors should be highlighted with an asterisk. |
export |
a logical value that indicates if plots should be exported as PDF. The output
directory will be the current working directory. The name of the file can be chosen using the
|
export_name |
a character vector that provides the name of the exported file if
|
A list containing Woods' plots is returned. Plotting peptide or precursor log2 fold changes along the protein sequence.
# Create example data data <- data.frame( fold_change = c(2.3, 0.3, -0.4, -4, 1), pval = c(0.001, 0.7, 0.9, 0.003, 0.03), start = c(20, 30, 45, 90, 140), end = c(33, 40, 64, 100, 145), protein_length = c(rep(150, 5)), protein_id = c(rep("P1", 5)) ) # Plot Woods' plot woods_plot( data = data, fold_change = fold_change, start_position = start, end_position = end, protein_length = protein_length, protein_id = protein_id, colouring = pval )# Create example data data <- data.frame( fold_change = c(2.3, 0.3, -0.4, -4, 1), pval = c(0.001, 0.7, 0.9, 0.003, 0.03), start = c(20, 30, 45, 90, 140), end = c(33, 40, 64, 100, 145), protein_length = c(rep(150, 5)), protein_id = c(rep("P1", 5)) ) # Plot Woods' plot woods_plot( data = data, fold_change = fold_change, start_position = start, end_position = end, protein_length = protein_length, protein_id = protein_id, colouring = pval )